3FEO: MBTD1

The crystal structure of MBTD1. Determined by X-ray diffraction at 2.5 Å resolution. Released 6 Jan 2009.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,279
Mol. weight: 99.13 kDa
Released: 6 Jan 2009

Explore 3FEO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FEO contains 41 α-helices and 55 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	14-21	8
β-strand	25	1	1
α-helix	26-27	2
α-helix	28-30	3
β-strand	48-52	5	2
β-strand	63-72	10	2
β-strand	75-80	6	2
β-strand	91-94	4	2
β-strand	101-102	2	2
α-helix	105-109	5
α-helix	111-112	2
β-strand	113	1	2
α-helix	117-119	3
α-helix	126-134	9
α-helix	144-151	8
β-strand	160-166	7	3
β-strand	169-182	14	3
β-strand	185-190	6	3
β-strand	199-203	5	3
β-strand	209-210	2	3
α-helix	214-218	5
β-strand	222	1	3
β-strand	235-236	2	3
α-helix	239-241	3
α-helix	243-247	5
β-strand	260-265	6	4
β-strand	268-280	13	4
α-helix	282-284	3
β-strand	285-290	6	4
β-strand	302-305	4	4
β-strand	311-312	2	4
α-helix	316-320	5
α-helix	323	1
β-strand	324-325	2	4
α-helix	326-327	2
α-helix	337-344	8
β-strand	348	1	4
α-helix	349-350	2
α-helix	351-354	4
β-strand	368-372	5	1
β-strand	380-389	10	1
β-strand	392-397	6	1
α-helix	402-404	3
β-strand	406-409	4	1
β-strand	415-416	2	1
α-helix	420-424	5
α-helix	426-427	2
β-strand	428-429	2	1
α-helix	430-431	2

Chain B: 19 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	14-21	8
β-strand	25	1	5
α-helix	26-27	2
α-helix	28-30	3
β-strand	48-52	5	6
β-strand	63-72	10	6
β-strand	75-80	6	6
β-strand	91-94	4	6
β-strand	101-102	2	6
β-strand	113	1	6
α-helix	117-119	3
α-helix	126-134	9
α-helix	144-151	8
β-strand	160-165	6	7
β-strand	172	1	8
β-strand	173-182	10	7
β-strand	185-190	6	7
β-strand	201-203	3	7
β-strand	209-210	2	7
α-helix	214-218	5
β-strand	221	1	8
β-strand	235-236	2	7
α-helix	237-238	2
α-helix	239-241	3
α-helix	244-246	3
β-strand	260-265	6	9
β-strand	268-280	13	9
β-strand	285-290	6	9
β-strand	302-305	4	9
β-strand	311-312	2	9
α-helix	316-319	4
β-strand	324-325	2	9
α-helix	326-327	2
α-helix	335	1
α-helix	337-343	7
β-strand	348	1	9
α-helix	349-350	2
α-helix	351-354	4
β-strand	368-372	5	5
β-strand	380-389	10	5
β-strand	392-397	6	5
α-helix	402-404	3
β-strand	406-409	4	5
β-strand	415-416	2	5
α-helix	420-424	5
β-strand	429	1	5
α-helix	430-431	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MBT domain-containing protein 1	A, B	protein	437	Homo sapiens	Q05BQ5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3FEO_1 MBT domain-containing protein 1 (chains A, B)
AKTKAAVSMEGFSWGNYINSNSFIAAPVTCFKHAPMGTCWGDISENVRVEVPNTDCSLPT
KVFWIAGIVKLAGYNALLRYEGFENDSGLDFWCNICGSDIHPVGWCAASGKPLVPPRTIQ
HKYTNWKAFLVKRLTGAKTLPPDFSQKVSESMQYPFKPCMRVEVVDKRHLCRTRVAVVES
VIGGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSDITKKQDGHFDTPPH
LFAKVKEVDQSGEWFKEGMKLEAIDPLNLSTICVATIRKVLADGFLMIGIDGSEAADGSD
WFCYHATSPSIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGSIAAPVKLFNKDVPN
HGFRVGMKLEAVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDCESPDLYPVGW
CQLTGYQLQPPASQSSR

Primary citation

Structural studies of a four-MBT repeat protein MBTD1. Eryilmaz, J., Pan, P., Amaya, M.F. et al. PLoS One (2009) 4:e7274-e7274. DOI 10.1371/journal.pone.0007274 · PubMed

Other PDB entries of the same protein (UniProt Q05BQ5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NFX 1.95 Å, MBTD1 MBT repeats
4C5I 2.59 Å, Crystal structure of MBTD1 YY1 complex

Browse structure collections

About this viewer

MolViewer shows 3FEO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.