MBTD1 MBT repeats. Determined by X-ray diffraction at 1.95 Å resolution. Released 30 Jan 2019.
Explore 6NFX in 3D Show helices and sheets RCSB PDB PDBe
6NFX contains 24 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 143-150 | 8 | |
| β-strand | 154 | 1 | 1 |
| α-helix | 155-156 | 2 | |
| α-helix | 157-159 | 3 | |
| α-helix | 166-168 | 3 | |
| β-strand | 177-181 | 5 | 2 |
| β-strand | 192-201 | 10 | 2 |
| β-strand | 204-209 | 6 | 2 |
| β-strand | 220-223 | 4 | 2 |
| β-strand | 230 | 1 | 2 |
| α-helix | 234-238 | 5 | |
| β-strand | 242 | 1 | 2 |
| α-helix | 246-248 | 3 | |
| α-helix | 255-263 | 9 | |
| α-helix | 273-280 | 8 | |
| β-strand | 289-295 | 7 | 3 |
| β-strand | 298-311 | 14 | 3 |
| β-strand | 314-319 | 6 | 3 |
| β-strand | 329-332 | 4 | 3 |
| β-strand | 339 | 1 | 3 |
| α-helix | 343-347 | 5 | |
| β-strand | 350-351 | 2 | 3 |
| β-strand | 364-365 | 2 | 3 |
| α-helix | 366-367 | 2 | |
| α-helix | 368-370 | 3 | |
| α-helix | 372-378 | 7 | |
| β-strand | 389-394 | 6 | 4 |
| β-strand | 397-409 | 13 | 4 |
| α-helix | 411-413 | 3 | |
| β-strand | 414-419 | 6 | 4 |
| β-strand | 431-434 | 4 | 4 |
| β-strand | 440-441 | 2 | 4 |
| α-helix | 445-448 | 4 | |
| α-helix | 452 | 1 | |
| β-strand | 453-454 | 2 | 4 |
| α-helix | 455-456 | 2 | |
| α-helix | 466-473 | 8 | |
| β-strand | 477 | 1 | 4 |
| α-helix | 478-479 | 2 | |
| α-helix | 480-483 | 4 | |
| β-strand | 497-501 | 5 | 1 |
| β-strand | 509-518 | 10 | 1 |
| β-strand | 521-526 | 6 | 1 |
| α-helix | 531-533 | 3 | |
| β-strand | 535-538 | 4 | 1 |
| β-strand | 544-545 | 2 | 1 |
| α-helix | 549-553 | 5 | |
| α-helix | 555-556 | 2 | |
| β-strand | 557-558 | 2 | 1 |
| α-helix | 559-560 | 2 | |
| α-helix | 590-597 | 8 | |
| β-strand | 600 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| MBT domain-containing protein 1,Enhancer of polycomb homolog 1 | A | protein | 470 | Homo sapiens | Q05BQ5 (AlphaFold model), Q9H2F5 (AlphaFold model) |
>6NFX_1 MBT domain-containing protein 1,Enhancer of polycomb homolog 1 (chains A) GGFSWGNYINSNSFIAAPVTCFKHAPMGTCWGDISENVRVEVPNTDCSLPTKVFWIAGIV KLAGYNALLRYEGFENDSGLDFWCNICGSDIHPVGWCAASGKPLVPPRTIQHKYTNWKAF LVKRLTGAKTLPPDFSQKVSESMQYPFKPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLV YEESEDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSDITKKQDGHFDTPPHLFAKVKEVD QSGEWFKEGMKLEAIDPLNLSTICVATIRKVLADGFLMIGIDGSEAADGSDWFCYHATSP SIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGSIAAPVKLFNKDVPNHGFRVGMKL EAVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDCESPDLYPVGWCQLTGYQLQ PPASGSAGSAGSAGSAGSAGSAQGFVSKTLDSASAQFAASALVTSEQLMG
Structural Basis for EPC1-Mediated Recruitment of MBTD1 into the NuA4/TIP60 Acetyltransferase Complex. Zhang, H., Devoucoux, M., Song, X. et al. Cell Rep (2020) 30:3996-4002.e4. DOI 10.1016/j.celrep.2020.03.003 · PubMed
Other PDB entries of the same protein (UniProt Q05BQ5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6NFX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.