Structure of NK cell receptor KLRG1. Determined by X-ray diffraction at 1.8 Å resolution. Released 28 Jul 2009.
Explore 3FF9 in 3D Show helices and sheets RCSB PDB PDBe
3FF9 contains 6 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 75-76 | 2 | |
| β-strand | 80-82 | 3 | 1 |
| β-strand | 85-89 | 5 | 1 |
| β-strand | 94 | 1 | 2 |
| α-helix | 96-105 | 10 | |
| β-strand | 109-110 | 2 | 1 |
| α-helix | 119-123 | 5 | |
| β-strand | 131-137 | 7 | 3 |
| β-strand | 141-143 | 3 | 3 |
| β-strand | 148 | 1 | 3 |
| β-strand | 155 | 1 | 3 |
| β-strand | 163-167 | 5 | 3 |
| β-strand | 170-174 | 5 | 3 |
| β-strand | 180 | 1 | 2 |
| β-strand | 181-182 | 2 | 3 |
| β-strand | 183-187 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Killer cell lectin-like receptor subfamily G member 1 | A, B | protein | 115 | Mus musculus | O88713 (AlphaFold model) |
>3FF9_1 Killer cell lectin-like receptor subfamily G member 1 (chains A, B) MCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWI GLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY
Structure of natural killer cell receptor KLRG1 bound to E-cadherin reveals basis for MHC-independent missing self recognition. Li, Y., Hofmann, M., Wang, Q. et al. Immunity (2009) 31:35-46. DOI 10.1016/j.immuni.2009.04.019 · PubMed
Other PDB entries of the same protein (UniProt O88713 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3FF9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.