3FF8: NK cell receptor KLRG1

Structure of NK cell receptor KLRG1 bound to E-cadherin. Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Jul 2009.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Homo sapiens, Mus musculus
Chains: 4
Atoms: 3,635
Mol. weight: 48.9 kDa
Ligands: CA
Released: 28 Jul 2009

Explore 3FF8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FF8 contains 8 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
β-strand	9-10	2	2
β-strand	19-23	5	3
β-strand	25-26	2	1
α-helix	27-30	4
β-strand	35-39	5	4
β-strand	41	1	5
β-strand	45	1	5
β-strand	51-53	3	3
β-strand	59-62	4	3
β-strand	73-81	9	4
β-strand	87	1	4
β-strand	92-97	6	4
β-strand	98-99	2	2

Chain B: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	6
β-strand	9	1	7
β-strand	19-23	5	8
β-strand	25-26	2	6
α-helix	27-30	4
β-strand	35-40	6	9
β-strand	41	1	10
β-strand	45	1	10
β-strand	51-53	3	8
β-strand	59-62	4	8
β-strand	73-81	9	9
β-strand	87	1	9
β-strand	92-97	6	9
β-strand	98	1	7

Chain C: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	79-82	4	11
β-strand	85-89	5	11
β-strand	94	1	12
α-helix	96-105	10
β-strand	109-110	2	11
α-helix	119-122	4
α-helix	123-125	3
β-strand	131-137	7	13
β-strand	141-143	3	13
β-strand	148	1	13
β-strand	155	1	13
β-strand	163-167	5	13
β-strand	170-174	5	13
β-strand	180	1	12
β-strand	181-182	2	13
β-strand	183-185	3	11

Chain D: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	80-82	3	14
β-strand	85-89	5	14
β-strand	94	1	15
α-helix	96-105	10
β-strand	109-110	2	14
α-helix	119-122	4
α-helix	123-125	3
β-strand	131-137	7	16
β-strand	141-143	3	16
β-strand	148	1	16
β-strand	154-155	2	16
β-strand	163-167	5	16
β-strand	170-174	5	16
β-strand	180	1	15
β-strand	181-182	2	16
β-strand	183-187	5	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Epithelial cadherin	A, B	protein	101	Homo sapiens	P12830 (AlphaFold model)
Killer cell lectin-like receptor subfamily G member 1	C, D	protein	114	Mus musculus	O88713 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3FF8_1 Epithelial cadherin (chains A, B)
MDWVIPPISLPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGW
LKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTD

Sequence of entity 2 (C, D), FASTA

>3FF8_2 Killer cell lectin-like receptor subfamily G member 1 (chains C, D)
CPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIG
LRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3

Primary citation

Structure of natural killer cell receptor KLRG1 bound to E-cadherin reveals basis for MHC-independent missing self recognition. Li, Y., Hofmann, M., Wang, Q. et al. Immunity (2009) 31:35-46. DOI 10.1016/j.immuni.2009.04.019 · PubMed

Other PDB entries of the same protein (UniProt P12830 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OMZ 1.6 Å, Crystal structure of InlA Y369A/hEC1 complex
2OMX 1.7 Å, Crystal structure of InlA S192N G194S+S/hEC1 complex
2OMY 1.7 Å, Crystal structure of InlA S192N/hEC1 complex
1O6S 1.8 Å, Internalin (Listeria monocytogenes) / E-Cadherin (human) Recognition Complex
2OMU 1.8 Å, Crystal structure of InlA G194S+S Y369S/hEC1 complex
3FF7 1.8 Å, Structure of NK cell receptor KLRG1 bound to E-cadherin
2OMV 1.9 Å, Crystal structure of InlA S192N Y369S/hEC1 complex
8H62 1.91 Å, Crystal structure of Internalin A from Listeria monocytogenes with human E-cadherin EC12
4ZT1 1.92 Å, Crystal structure of human E-Cadherin (residues 3-213) in x-dimer conformation
2O72 2.0 Å, Crystal Structure Analysis of human E-cadherin (1-213)
2OMT 2.0 Å, Crystal structure of InlA G194S+S/hEC1 complex
4ZTE 2.13 Å, Crystal structure of human E-Cadherin (residues 3-213) in complex with a peptidomimetic…

Browse structure collections

About this viewer

MolViewer shows 3FF8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.