3FI1: NhaA dimer model

NhaA dimer model. Determined by electron crystallography at 7.0 Å resolution. Released 13 Jan 2009.

Method: Electron crystallography
Resolution: 7.0 Å
Organism: Escherichia coli K-12
Chains: 1
Atoms: 2,809
Mol. weight: 39.85 kDa
Released: 13 Jan 2009

Explore 3FI1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FI1 contains 25 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	11-30	20
α-helix	35-42	8
β-strand	47-49	3	1
β-strand	54-56	3	1
α-helix	61-84	24
α-helix	95-104	10
α-helix	109-112	4
α-helix	113-115	3
α-helix	122-125	4
α-helix	134-142	9
α-helix	153-174	22
α-helix	181-199	19
α-helix	206-218	13
α-helix	223-236	14
α-helix	241-243	3
α-helix	247-258	12
α-helix	259-263	5
α-helix	264-271	8
α-helix	284-287	4
α-helix	294-298	5
α-helix	301-303	3
α-helix	307-310	4
α-helix	325-328	4
α-helix	331-334	4
α-helix	339-349	11
α-helix	358-370	13
α-helix	378-380	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Na(+)/H(+) antiporter nhaA	A	protein	376	Escherichia coli K-12	P13738 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3FI1_1 Na(+)/H(+) antiporter nhaA (chains A)
SSDASGGIILIIAAILAMIMANSGATSGWYHDFLETPVQLRVGSLEINKNMLLWINDALM
AVFFLLVGLEVKRELMQGSLASLRQAAFPVIAAIGGMIVPALLYLAFNYADPITREGWAI
PAATDIAFALGVLALLGSRVPLALKIFLMALAIIDDLGAIIIIALFYTNDLSMASLGVAA
VAIAVLAVLNLCGARRTGVYILVGVVLWTAVLKSGVHATLAGVIVGFFIPLKEKHGRSPA
KRLEHVLHPWVAYLILPLFAFANAGVSLQGVTLDGLTSILPLGIIAGLLIGKPLGISLFC
WLALRLKLAHLPEGTTYQQIMVVGILCGIGFTMSIFIASLAFGSVDPELINWAKLGILVG
SISSAVIGYSWLRVRL

Primary citation

Conformations of NhaA, the Na/H exchanger from Escherichia coli, in the pH-activated and ion-translocating states. Appel, M., Hizlan, D., Vinothkumar, K.R. et al. J Mol Biol (2009) 386:351-365. DOI 10.1016/j.jmb.2008.12.042 · PubMed

Other PDB entries of the same protein (UniProt P13738 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S24 2.2 Å, Crystal structure of the Na+/H+ antiporter NhaA at pH 6.5
9RH1 2.7 Å, Cryo-EM structure of the consensus inward-facing apo NhaA dimer at pH 7.5
9RH2 2.7 Å, Cryo-EM structure of the inward-facing apo NhaA in the unplugged state at pH 7.5
9RH3 2.7 Å, Cryo-EM structure of the inward-facing apo NhaA in the plugged state at pH 7.5
9RHB 2.9 Å, Cryo-EM structure of the inward-facing apo NhaA in the open-funnel state at pH 8.5
9RHF 3.0 Å, Cryo-EM structure of the inward-facing sodium-bound NhaA at pH 8.5
9RH4 3.1 Å, Cryo-EM structure of the inward-facing apo NhaA with flexible N-terminus at pH 7.5
9RH8 3.1 Å, Cryo-EM structure of the inward-facing apo NhaA in the unplugged state at pH 5.5
9RH9 3.1 Å, Cryo-EM structure of the inward-facing apo NhaA in the plugged state at pH 5.5
9RHC 3.2 Å, Cryo-EM structure of the inward-facing apo NhaA in the unplugged state at pH 8.5
9RHD 3.2 Å, Cryo-EM structure of the inward-facing apo NhaA in the plugged state at pH 8.5
9RH5 3.3 Å, Cryo-EM structure of the inward-facing apo NhaA in the unplugged state at pH 6.3

Browse structure collections

About this viewer

MolViewer shows 3FI1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.