3FLD: Trai c-terminal domain

Crystal structure of the trai c-terminal domain. Determined by X-ray diffraction at 2.4 Å resolution. Released 10 Feb 2009.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Escherichia coli K-12
Chains: 2
Atoms: 2,452
Mol. weight: 33.35 kDa
Released: 10 Feb 2009

Explore 3FLD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FLD contains 14 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	1477-1487	11
α-helix	1489	1
β-strand	1490	1	1
α-helix	1491-1493	3
α-helix	1495-1504	10
β-strand	1510	1	2
β-strand	1514-1516	3	1
α-helix	1523-1525	3
β-strand	1526-1532	7	3
β-strand	1538-1545	8	3
β-strand	1547-1549	3	4
β-strand	1553-1555	3	4
β-strand	1562-1565	4	3
β-strand	1571-1575	5	3
β-strand	1576	1	5
β-strand	1581-1585	5	3
α-helix	1588-1597	10
β-strand	1602-1606	5	3
α-helix	1616-1618	3
β-strand	1624-1625	2	3

Chain B: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	1477-1486	10
α-helix	1489	1
β-strand	1490	1	3
α-helix	1491-1493	3
α-helix	1495-1503	9
β-strand	1510	1	5
β-strand	1514-1516	3	3
α-helix	1523-1525	3
β-strand	1526-1532	7	1
β-strand	1538-1545	8	1
β-strand	1547-1549	3	6
β-strand	1553-1555	3	6
β-strand	1562-1565	4	1
β-strand	1571-1575	5	1
β-strand	1576	1	2
β-strand	1581-1585	5	1
α-helix	1588-1597	10
β-strand	1602-1606	5	1
α-helix	1616-1618	3
β-strand	1624-1625	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein traI	A, B	protein	153	Escherichia coli K-12	P14565 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3FLD_1 Protein traI (chains A, B)
REVMNAERLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRN
GKSAGIWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIA
RDNPDSGVVVRIAGEGRPWNPGAITGGRVWGDI

Primary citation

A novel fold in the TraI relaxase-helicase c-terminal domain is essential for conjugative DNA transfer. Guogas, L.M., Kennedy, S.A., Lee, J.H. et al. J Mol Biol (2009) 386:554-568. DOI 10.1016/j.jmb.2008.12.057 · PubMed

Other PDB entries of the same protein (UniProt P14565 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Q7T 2.42 Å, Crystal Structure of the F plasmid TraI Relaxase Domain with the Scissile Thymidine Base
1P4D 2.6 Å, F factor TraI Relaxase Domain
2A0I 2.72 Å, F Factor TraI Relaxase Domain bound to F oriT Single-stranded DNA
9F10 2.94 Å, CryoEM structure of the F plasmid relaxosome with TraI in its TE mode, without accessory…
2Q7U 3.0 Å, Crystal Structure of the F plasmid TraI Relaxase Domain with the Scissile Thymidine Base…
9F0Z 3.42 Å, CryoEM structure of the F plasmid relaxosome with truncated TraI1-863 in its TE mode,…
9F12 3.42 Å, CryoEM structure of the F plasmid relaxosome with oriT DNA ss-27_-3ds-2_+143 and TraI…
9F0Y 3.45 Å, CryoEM structure of the F plasmid relaxosome with TraI in its TE mode, derived from the…
9F11 3.68 Å, CryoEM structure of the F plasmid relaxosome with oriT DNA ss-27_+3ds+4_+143 and TraI…
9F0X 3.78 Å, CryoEM structure of the F plasmid relaxosome in its pre-initiation state, derived from…
2L8B TraI (381-569)

Browse structure collections

About this viewer

MolViewer shows 3FLD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.