3FMV: Serine phosphatase of RNA polymerase II CTD

Crystal structure of the serine phosphatase of RNA polymerase II CTD (SSU72 superfamily) from Drosophila melanogaster. Monoclinic crystal form. Northeast Structural Genomics Consortium target FR253. Determined by X-ray diffraction at 3.31 Å resolution. Released 6 Jan 2009.

Method: X-ray diffraction
Resolution: 3.31 Å
Organism: Drosophila melanogaster
Chains: 8
Atoms: 12,432
Mol. weight: 186.61 kDa
Released: 6 Jan 2009

Explore 3FMV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FMV contains 56 α-helices and 67 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	1
α-helix	19-29	11
β-strand	34-38	5	1
β-strand	43-45	3	2
β-strand	54-56	3	2
α-helix	62-70	9
α-helix	74-80	7
α-helix	82-90	9
β-strand	98	1	1
β-strand	108-111	4	1
α-helix	114-124	11
β-strand	134-139	6	1
α-helix	146-164	19
α-helix	169-184	16
β-strand	190-194	5	1

Chain B: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	3
α-helix	19-29	11
β-strand	33-38	6	3
β-strand	43-47	5	4
β-strand	53-56	4	4
α-helix	62-70	9
α-helix	74-79	6
α-helix	82-90	9
β-strand	98	1	3
β-strand	108-111	4	3
α-helix	114-124	11
β-strand	134-139	6	3
α-helix	146-164	19
α-helix	169-183	15
β-strand	189-194	6	3

Chain C: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	5
α-helix	19-30	12
β-strand	34-38	5	5
β-strand	43-45	3	6
β-strand	54-56	3	6
α-helix	62-70	9
α-helix	76-79	4
α-helix	82-89	8
β-strand	98	1	5
β-strand	108-111	4	5
α-helix	114-124	11
β-strand	134-139	6	5
α-helix	148-164	17
α-helix	169-183	15
β-strand	192-194	3	5

Chain D: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	7
α-helix	19-29	11
β-strand	34-38	5	7
β-strand	43-45	3	8
β-strand	54-56	3	8
α-helix	62-70	9
α-helix	74-79	6
α-helix	82-90	9
β-strand	98	1	7
β-strand	108-111	4	7
α-helix	114-126	13
β-strand	134-139	6	7
α-helix	148-164	17
α-helix	169-183	15
β-strand	192-194	3	7

Chain E: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	9
α-helix	19-29	11
β-strand	33-38	6	9
β-strand	43-45	3	10
β-strand	54-56	3	10
α-helix	62-70	9
α-helix	74-79	6
α-helix	82-92	11
β-strand	98	1	9
β-strand	108-111	4	9
α-helix	114-124	11
β-strand	136-140	5	9
α-helix	148-164	17
α-helix	169-182	14
β-strand	188-189	2	9
β-strand	192	1	9

Chain F: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	11
α-helix	19-29	11
β-strand	34-38	5	11
β-strand	43-45	3	12
β-strand	54-56	3	12
α-helix	62-71	10
α-helix	74-79	6
α-helix	82-92	11
β-strand	98	1	11
β-strand	108-111	4	11
α-helix	114-124	11
β-strand	134-135	2	13
β-strand	136-139	4	11
α-helix	148-164	17
α-helix	169-180	12
β-strand	193-194	2	13

Chain G: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	14
α-helix	19-30	12
β-strand	33-38	6	14
β-strand	43-45	3	15
β-strand	54-56	3	15
α-helix	62-70	9
α-helix	74-79	6
α-helix	82-92	11
β-strand	98	1	14
β-strand	108-111	4	14
α-helix	114-124	11
β-strand	134-135	2	16
β-strand	136-139	4	14
α-helix	148-164	17
α-helix	169-184	16
β-strand	193-194	2	16

Chain H: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	17
α-helix	19-29	11
β-strand	34-38	5	17
β-strand	43-49	7	18
β-strand	52-56	5	18
α-helix	62-70	9
α-helix	74-79	6
α-helix	82-90	9
β-strand	98	1	17
β-strand	108-111	4	17
α-helix	114-122	9
β-strand	134-139	6	17
α-helix	146-164	19
α-helix	169-184	16
β-strand	189-194	6	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine phosphatase of RNA polymerase II CTD	A, B, C, D, E, F, G, H	protein	195	Drosophila melanogaster	Q9VWE4 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>3FMV_1 Serine phosphatase of RNA polymerase II CTD (chains A, B, C, D, E, F, G, H)
MTDPSKLAVAVVCSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGMAFDKPNVYEFGT
KYEDIYRDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTKEQFDIIVTVEERVYDLV
VMHMESMESVDNRPVHVLNVDVVDNAEDALMGAFVITDMINMMAKSTDLDNDIDELIQEF
EERRKRVILHSVLFY

Primary citation

Crystal structure of the serine phosphatase of RNA polymerase II CTD (SSU72 superfamily) from Drosophila melanogaster. Monoclinic crystal form. Northeast Structural Genomics Consortium target FR253. Kuzin, A.P., Chen, Y., Seetharaman, J. et al. To be published.

Other PDB entries of the same protein (UniProt Q9VWE4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3P9Y 2.1 Å, Crystal structure of the Drosophila melanogaster Ssu72-pCTD complex
3OMX 2.34 Å, Crystal structure of Ssu72 with vanadate complex
4IMI 2.35 Å, Novel Modifications on C-terminal Domain of RNA Polymerase II can Fine- tune the…
6NPW 2.49 Å, SSu72/Sympk in complex with Ser2/Ser5 phosphorylated peptide
4IMJ 2.58 Å, Novel Modifications on C-terminal Domain of RNA Polymerase II can Fine-tune the…
3OMW 2.87 Å, Crystal structure of Ssu72, an essential eukaryotic phosphatase specific for the…
4YGX 2.95 Å, Crystal Structure of D. melanogaster Ssu72+Symplekin bound to cis peptidomimetic CTD…
3FDF 3.2 Å, Crystal structure of the serine phosphatase of RNA polymerase II CTD (SSU72 superfamily)…

Browse structure collections

About this viewer

MolViewer shows 3FMV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.