3FP4: Tom71

Crystal structure of Tom71 complexed with Ssa1 C-terminal fragment. Determined by X-ray diffraction at 2.14 Å resolution. Released 28 Jul 2009.

Method: X-ray diffraction
Resolution: 2.14 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 4,391
Mol. weight: 62.52 kDa
Released: 28 Jul 2009

Explore 3FP4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FP4 contains 27 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 0 β-strands

Element	Residues	Length
α-helix	112-116	5
α-helix	120-139	20
α-helix	143-154	12
α-helix	161-172	12
α-helix	177-190	14
α-helix	195-207	13
α-helix	211-221	11
α-helix	235-251	17
α-helix	266-273	8
α-helix	278-282	5
α-helix	295-306	12
α-helix	310-331	22
α-helix	338-357	20
α-helix	361-374	14
α-helix	378-387	10
α-helix	395-407	13
α-helix	412-424	13
α-helix	428-441	14
α-helix	446-458	13
α-helix	462-475	14
α-helix	481-492	12
α-helix	496-512	17
α-helix	521-533	13
α-helix	543-559	17
α-helix	564-576	13
α-helix	580-593	14
α-helix	597-617	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TPR repeat-containing protein YHR117W	A	protein	537	Saccharomyces cerevisiae	P38825 (AlphaFold model)
Ssa1	Q	protein	12		Q10265 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3FP4_1 TPR repeat-containing protein YHR117W (chains A)
GSHMNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPV
FYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLS
LNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEV
SSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRE
NAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQ
KAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKF
TESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGP
LIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDE
AIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML

Sequence of entity 2 (Q), FASTA

>3FP4_2 Ssa1 (chains Q)
GADNGPTVEEVD

Primary citation

Molecular chaperone Hsp70/Hsp90 prepares the mitochondrial outer membrane translocon receptor Tom71 for preprotein loading. Li, J., Qian, X., Hu, J. et al. J Biol Chem (2009) 284:23852-23859. DOI 10.1074/jbc.M109.023986 · PubMed

Other PDB entries of the same protein (UniProt P38825 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FP2 1.98 Å, Crystal structure of Tom71 complexed with Hsp82 C-terminal fragment
3FP3 1.98 Å, Crystal structure of Tom71
3LCA 2.19 Å, Structure of Tom71 complexed with Hsp70 Ssa1 C terminal tail indicating conformational…

Browse structure collections

About this viewer

MolViewer shows 3FP4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.