3FPR: Evasin-1

Crystal Structure of Evasin-1. Determined by X-ray diffraction at 1.63 Å resolution. Released 12 Jan 2010.

Method: X-ray diffraction
Resolution: 1.63 Å
Organism: Rhipicephalus sanguineus
Chains: 2
Atoms: 1,418
Mol. weight: 22.61 kDa
Released: 12 Jan 2010

Explore 3FPR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FPR contains 8 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	12-13	2
β-strand	14-15	2	1
β-strand	16-18	3	2
β-strand	24-26	3	2
β-strand	30-33	4	3
β-strand	36-39	4	3
α-helix	40-41	2
β-strand	45-47	3	2
α-helix	50-56	7
α-helix	58	1
β-strand	63-71	9	2
β-strand	74-85	12	2

Chain D: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
β-strand	16-18	3	1
β-strand	24-26	3	1
β-strand	30-33	4	4
β-strand	36-39	4	4
α-helix	40-41	2
β-strand	45-47	3	1
α-helix	50-55	6
α-helix	58	1
β-strand	63-71	9	1
β-strand	74-85	12	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Evasin-1	A, D	protein	100	Rhipicephalus sanguineus	P0C8E7 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>3FPR_1 Evasin-1 (chains A, D)
EDDEDYGDLGGCPFLVAENKTGYPTIVACKQDCNGTTETAPNGTRCFSIGDEGLRRMTAN
LPYDCPLGQCSNGDCIPKETYEVCYRRNWRDKKNHHHHHH

Primary citation

Structural basis of chemokine sequestration by a tick chemokine binding protein: the crystal structure of the complex between Evasin-1 and CCL3. Dias, J.M., Losberger, C., Deruaz, M. et al. PLoS One (2009) 4. DOI 10.1371/journal.pone.0008514 · PubMed

Other PDB entries of the same protein (UniProt P0C8E7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FPU 1.76 Å, The crystallographic structure of the Complex between Evasin-1 and CCL3
3FPT 2.7 Å, The Crystal Structure of the Complex between Evasin-1 and CCL3

Browse structure collections

About this viewer

MolViewer shows 3FPR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.