3FPT: Complex between Evasin-1 and CCL3

The Crystal Structure of the Complex between Evasin-1 and CCL3. Determined by X-ray diffraction at 2.7 Å resolution. Released 26 Jan 2010.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Rhipicephalus sanguineus
Chains: 3
Atoms: 2,007
Mol. weight: 35.25 kDa
Ligands: NAG
Released: 26 Jan 2010

Explore 3FPT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FPT contains 12 α-helices and 28 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	13-14	2
β-strand	15	1	1
β-strand	16-18	3	2
β-strand	24-26	3	2
β-strand	30-33	4	3
β-strand	36-39	4	3
β-strand	45-47	3	2
α-helix	51-55	5
α-helix	58	1
β-strand	63-71	9	2
β-strand	74-85	12	2
α-helix	89-91	3

Chain B: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	13-14	2
β-strand	15	1	4
β-strand	16-18	3	5
β-strand	24-26	3	5
β-strand	30-31	2	6
β-strand	38-39	2	6
α-helix	40-41	2
β-strand	45-47	3	5
α-helix	50-56	7
α-helix	58	1
β-strand	63-64	2	1
β-strand	67-71	5	5
β-strand	74-80	7	5
β-strand	83-84	2	1
β-strand	85	1	5

Chain C: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
β-strand	16-18	3	4
β-strand	24-26	3	4
β-strand	30-33	4	7
β-strand	36-39	4	7
β-strand	45-47	3	4
α-helix	50-56	7
α-helix	58	1
β-strand	59	1	8
β-strand	63-71	9	4
β-strand	74-85	12	4
β-strand	86	1	8
α-helix	87-88	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Evasin-1	A, B, C	protein	100	Rhipicephalus sanguineus	P0C8E7 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3FPT_1 Evasin-1 (chains A, B, C)
EDDEDYGDLGGCPFLVAENKTGYPTIVACKQDCNGTTETAPNGTRCFSIGDEGLRRMTAN
LPYDCPLGQCSNGDCIPKETYEVCYRRNWRDKKNHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	6

Primary citation

Structural basis of chemokine sequestration by a tick chemokine binding protein: the crystal structure of the complex between Evasin-1 and CCL3. Dias, J.M., Losberger, C., Deruaz, M. et al. PLoS One (2009) 4. DOI 10.1371/journal.pone.0008514 · PubMed

Other PDB entries of the same protein (UniProt P0C8E7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FPR 1.63 Å, Crystal Structure of Evasin-1
3FPU 1.76 Å, The crystallographic structure of the Complex between Evasin-1 and CCL3

Browse structure collections

About this viewer

MolViewer shows 3FPT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.