3FRP: Cobra venom factor alpha chain

Crystal Structure of Cobra Venom Factor, a Co-factor for C3- and C5 convertase CVFBb. Determined by X-ray diffraction at 2.61 Å resolution. Released 28 Apr 2009.

Method: X-ray diffraction
Resolution: 2.61 Å
Organism: Naja kaouthia
Chains: 3
Atoms: 9,156
Mol. weight: 141.67 kDa
Ligands: CA
Released: 28 Apr 2009

Explore 3FRP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FRP contains 23 α-helices and 103 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 57 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	10-12	3	2
β-strand	13	1	3
β-strand	17-18	2	4
β-strand	20-24	5	1
β-strand	30-39	10	2
β-strand	45-53	9	2
α-helix	55-57	3
β-strand	60-61	2	1
β-strand	64-65	2	4
β-strand	67	1	3
β-strand	81-88	8	2
β-strand	91-100	10	2
β-strand	106-110	5	5
β-strand	114-115	2	6
β-strand	120-121	2	7
β-strand	123-127	5	5
β-strand	139-144	6	6
β-strand	150-152	3	6
β-strand	155-156	2	6
β-strand	157	1	8
β-strand	160	1	8
α-helix	162-163	2
β-strand	164-165	2	7
β-strand	173-181	9	6
β-strand	188-194	7	6
β-strand	202-208	7	9
β-strand	212-214	3	10
β-strand	221-229	9	9
α-helix	233	1
β-strand	234	1	9
α-helix	235	1
β-strand	237-247	11	10
β-strand	250-253	4	10
β-strand	259-263	5	10
β-strand	264	1	9
β-strand	267-272	6	9
α-helix	274-280	7
β-strand	291-300	10	10
β-strand	306-317	12	10
β-strand	322-324	3	11
β-strand	331-332	2	12
β-strand	338-345	8	11
β-strand	351	1	11
β-strand	356-359	4	12
α-helix	360-362	3
β-strand	364-367	4	12
β-strand	373-378	6	11
β-strand	386-393	8	12
α-helix	400-402	3
β-strand	405-412	8	12
α-helix	413-415	3
β-strand	422-426	5	13
β-strand	437-445	9	13
α-helix	448-451	4
β-strand	456-463	8	14
β-strand	466-474	9	14
β-strand	481-487	7	13
α-helix	490-492	3
β-strand	495-504	10	14
β-strand	508-517	10	14
β-strand	527-529	3	15
β-strand	535	1	16
β-strand	540-547	8	15
β-strand	552-559	8	16
α-helix	561-565	5
α-helix	573-581	9
β-strand	590	1	14
α-helix	595-601	7
β-strand	604-608	5	1
α-helix	614-616	3

Chain B: 7 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	1255-1258	4	21
β-strand	1266-1268	3	21
β-strand	1282-1283	2	20
β-strand	1289-1292	4	21
β-strand	1300-1309	10	20
β-strand	1321-1329	9	22
β-strand	1341-1349	9	22
β-strand	1355-1363	9	23
α-helix	1364-1365	2
β-strand	1368-1370	3	22
β-strand	1371	1	24
α-helix	1372-1379	8
β-strand	1385	1	23
β-strand	1391-1392	2	24
β-strand	1395-1396	2	24
β-strand	1400-1408	9	23
β-strand	1414-1422	9	22
α-helix	1429-1431	3
β-strand	1432-1438	7	23
β-strand	1441-1450	10	23
α-helix	1458-1460	3
β-strand	1461-1464	4	25
β-strand	1467-1470	4	25
β-strand	1479	1	26
α-helix	1486-1492	7
β-strand	1500-1510	11	26
β-strand	1517-1527	11	26
β-strand	1539-1542	4	26
α-helix	1545-1547	3
β-strand	1558-1563	6	26
β-strand	1568	1	26
β-strand	1575-1578	4	26
β-strand	1584-1588	5	26
α-helix	1600-1616	17

Chain G: 2 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	726	1	17
β-strand	732-739	8	16
α-helix	743-744	2
β-strand	750-757	8	15
β-strand	763-773	11	16
β-strand	777-780	4	16
α-helix	781-783	3
β-strand	784-788	5	16
β-strand	792-796	5	18
β-strand	802-803	2	17
β-strand	808-816	9	18
β-strand	822-828	7	17
β-strand	834-835	2	19
β-strand	844-850	7	17
β-strand	854-862	9	18
β-strand	863-864	2	19
β-strand	868-878	11	17
β-strand	884-894	11	17
β-strand	898-908	11	20
β-strand	920-923	4	21
β-strand	938-943	6	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cobra venom factor alpha chain	A	protein	627	Naja kaouthia	Q91132 (AlphaFold model)
Cobra venom factor gamma chain	G	protein	252	Naja kaouthia	Q91132 (AlphaFold model)
Cobra venom factor beta chain	B	protein	379	Naja kaouthia	Q91132 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3FRP_1 Cobra venom factor alpha chain (chains A)
ALYTLITPAVLRTDTEEQILVEAHGDSTPKQLDIFVHDFPRKQKTLFQTRVDMNPAGGML
VTPTIEIPAKEVSTDSRQNQYVVVQVTGPQVRLEKVVLLSYQSSFLFIQTDKGIYTPGSP
VLYRVFSMDHNTSKMNKTVIVEFQTPEGILVSSNSVDLNFFWPYNLPDLVSLGTWRIVAK
YEHSPENYTAYFDVRKYVLPSFEVRLQPSEKFFYIDGNENFHVSITARYLYGEEVEGVAF
VLFGVKIDDAKKSIPDSLTRIPIIDGDGKATLKRDTFRSRFPNLNELVGHTLYASVTVMT
ESGSDMVVTEQSGIHIVASPYQIHFTKTPKYFKPGMPYELTVYVTNPDGSPAAHVPVVSE
AFHSMGTTLSDGTAKLILNIPLNAQSLPITVRTNHGDLPRERQATKSMTAIAYQTQGGSG
NYLHVAITSTEIKPGDNLPVNFNVKGNANSLKQIKYFTYLILNKGKIFKVGRQPRRDGQN
LVTMNLHITPDLIPSFRFVAYYQVGNNEIVADSVWVDVKDTCMGTLVVKGDNLIQMPGAA
MKIKLEGDPGARVGLVAVDKAVYVLNDKYKISQAKIWDTIEKSDFGCTAGSGQNNLGVFE
DAGLALTTSTNLNTKQRSAAKCPQPAN

Sequence of entity 2 (G), FASTA

>3FRP_2 Cobra venom factor gamma chain (chains G)
DDNEDGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAV
SFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLY
NPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKK
LKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDPVAQ
IIENSIDGSKLN

Sequence of entity 3 (B), FASTA

>3FRP_3 Cobra venom factor beta chain (chains B)
EIQMPTHKDLNLDITIELPDREVPIRYRINYENALLARTVETKLNQDITVTASGDGKATM
TILTFYNAQLQEKANVCNKFHLNVSVENIHLNAMGAKGALMLKICTRYLGEVDSTMTIID
ISMLTGFLPDAEDLTRLSKGVDRYISRYEVDNNMAQKVAVIIYLNKVSHSEDECLHFKIL
KHFEVGFIQPGSVKVYSYYNLDEKCTKFYHPDKGTGLLNKICIGNVCRCAGETCSSLNHQ
ERIDVPLQIEKACETNVDYVYKTKLLRIEEQDGNDIYVMDVLEVIKQGTDENPRAKTHQY
ISQRKCQEALNLKVNDDYLIWGSRSDLLPTKDKISYIITKNTWIERWPHEDECQEEEFQK
LCDDFAQFSYTLTEFGCPT

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

The Crystal Structure of Cobra Venom Factor, a Cofactor for C3- and C5-Convertase CVFBb. Krishnan, V., Ponnuraj, K., Xu, Y. et al. Structure (2009) 17:611-619. DOI 10.1016/j.str.2009.01.015 · PubMed

Other PDB entries of the same protein (UniProt Q91132 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HRZ 2.2 Å, Cobra Venom Factor (CVF) in complex with human factor B
3HS0 3.0 Å, Cobra Venom Factor (CVF) in complex with human factor B
8AYH 3.35 Å, Structure of Complement C5 in Complex with small molecule inhibitor and CVF
3PRX 4.3 Å, Structure of Complement C5 in Complex with CVF and SSL7
9TDL 4.3 Å, Complex between complement C5 and cobra venom factor, re-refined

Browse structure collections

About this viewer

MolViewer shows 3FRP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.