3PRX: Complement C5

Structure of Complement C5 in Complex with CVF and SSL7. Determined by X-ray diffraction at 4.3 Å resolution. Released 19 Jan 2011.

Method: X-ray diffraction
Resolution: 4.3 Å
Organisms: Homo sapiens, Naja kaouthia, Staphylococcus aureus
Chains: 6
Atoms: 48,236
Mol. weight: 800.65 kDa
Ligands: NAG
Released: 19 Jan 2011

Explore 3PRX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PRX contains 138 α-helices and 486 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 38 helices, 118 β-strands

Element	Residues	Length	Sheet
β-strand	23-28	6	1
β-strand	31-32	2	2
β-strand	37-43	7	1
β-strand	50-57	8	3
β-strand	65-73	9	3
β-strand	81-85	5	1
β-strand	102-108	7	3
β-strand	112-117	6	3
β-strand	119-120	2	2
β-strand	125-130	6	4
β-strand	134-135	2	5
β-strand	140-148	9	4
β-strand	159-164	6	5
β-strand	170-176	7	5
β-strand	182-189	8	4
β-strand	197-205	9	5
β-strand	212-219	8	5
β-strand	221-222	2	6
β-strand	228-233	6	7
β-strand	237-238	2	8
α-helix	240-242	3
β-strand	246-253	8	7
β-strand	259	1	7
β-strand	262-263	2	7
β-strand	264-272	9	8
β-strand	281-282	2	8
β-strand	292-293	2	7
β-strand	296-301	6	7
α-helix	303-307	5
α-helix	309-311	3
α-helix	316-318	3
β-strand	322-330	9	8
β-strand	338-342	5	8
β-strand	346-347	2	8
β-strand	352-356	5	9
β-strand	362-363	2	10
β-strand	368-377	10	9
β-strand	382	1	9
β-strand	387-396	10	10
β-strand	401-410	10	10
β-strand	417-423	7	9
β-strand	428-437	10	10
β-strand	449-456	8	10
α-helix	457-458	2
β-strand	466-469	4	11
β-strand	481-487	7	11
β-strand	498-505	8	12
β-strand	508-516	9	12
β-strand	524-529	6	11
α-helix	532-534	3
β-strand	538-545	8	12
β-strand	554-561	8	12
β-strand	572-575	4	13
β-strand	582	1	14
β-strand	587-593	7	13
β-strand	599-601	3	15
β-strand	604-606	3	16
α-helix	607-610	4
α-helix	622-626	5
β-strand	637	1	12
α-helix	642-647	6
β-strand	651-653	3	1
α-helix	681-689	9
α-helix	698-701	4
α-helix	711-715	5
α-helix	722-738	17
β-strand	764-765	2	6
β-strand	773	1	16
β-strand	777-779	3	15
β-strand	783-789	7	13
β-strand	796-799	4	16
β-strand	802	1	17
β-strand	803	1	15
β-strand	805	1	18
β-strand	808	1	18
β-strand	811	1	17
β-strand	815-818	4	16
β-strand	819	1	14
β-strand	823-828	6	19
β-strand	833-834	2	20
β-strand	835	1	21
β-strand	837	1	21
β-strand	840-847	8	19
β-strand	853-859	7	22
β-strand	874	1	23
β-strand	879	1	23
β-strand	886-888	3	22
β-strand	892-899	8	19
β-strand	910-916	7	22
β-strand	919-925	7	22
β-strand	929-930	2	20
β-strand	935	1	24
β-strand	942-944	3	25
β-strand	945-950	6	26
β-strand	952-954	3	26
β-strand	956-959	4	27
β-strand	967	1	28
α-helix	968	1
β-strand	974-980	7	25
α-helix	985-992	8
α-helix	1009-1013	5
α-helix	1016-1024	9
α-helix	1025-1029	5
α-helix	1031-1033	3
α-helix	1038-1057	20
β-strand	1060	1	29
β-strand	1066	1	29
β-strand	1067	1	30
β-strand	1074	1	30
α-helix	1076-1089	14
α-helix	1097-1110	14
β-strand	1112	1	31
β-strand	1118	1	31
α-helix	1133-1155	23
α-helix	1156-1158	3
α-helix	1162-1179	18
α-helix	1185-1196	12
α-helix	1203-1213	11
β-strand	1217-1219	3	32
β-strand	1225-1227	3	32
α-helix	1245-1261	17
α-helix	1264-1267	4
α-helix	1268-1275	8
α-helix	1279	1
α-helix	1288-1303	16
α-helix	1306-1308	3
β-strand	1311-1317	7	27
β-strand	1322-1328	7	27
α-helix	1336-1338	3
β-strand	1339-1340	2	25
β-strand	1346-1350	5	27
β-strand	1357-1364	8	25
β-strand	1365	1	24
β-strand	1367	1	28
β-strand	1377-1384	8	33
β-strand	1400-1408	9	33
β-strand	1422-1425	4	34
α-helix	1427-1429	3
β-strand	1432-1434	3	33
α-helix	1436-1444	9
β-strand	1453-1456	4	34
β-strand	1459-1464	6	34
β-strand	1473-1481	9	33
β-strand	1491-1497	7	34
β-strand	1500-1509	10	34
α-helix	1542-1545	4
β-strand	1559-1571	13	35
β-strand	1574-1580	7	35
β-strand	1586	1	35
β-strand	1597-1601	5	35
β-strand	1616-1621	6	35
β-strand	1626-1627	2	36
β-strand	1634-1635	2	36
β-strand	1636-1637	2	35
β-strand	1645-1647	3	35
α-helix	1657-1673	17

Chain B: 26 helices, 105 β-strands

Element	Residues	Length	Sheet
β-strand	24-30	7	37
β-strand	32-34	3	38
β-strand	39-40	2	39
β-strand	42-46	5	37
β-strand	52-60	9	38
β-strand	67-75	9	38
β-strand	82-83	2	37
β-strand	86-87	2	39
α-helix	91-93	3
β-strand	103-110	8	38
β-strand	113-122	10	38
β-strand	128-132	5	40
β-strand	136-137	2	41
β-strand	142-144	3	42
β-strand	145-149	5	40
β-strand	161-166	6	41
β-strand	172-178	7	41
β-strand	185-187	3	42
β-strand	195-203	9	41
β-strand	206-216	11	41
β-strand	224-230	7	43
β-strand	234-236	3	44
β-strand	243-251	9	43
β-strand	256	1	43
β-strand	259-269	11	44
β-strand	272-275	4	44
α-helix	277-279	3
β-strand	281-285	5	44
β-strand	286	1	43
β-strand	289-294	6	43
α-helix	296-302	7
α-helix	306-308	3
β-strand	312-322	11	44
β-strand	328-339	12	44
β-strand	344-346	3	45
β-strand	353-354	2	46
β-strand	360-367	8	45
β-strand	373	1	45
β-strand	378-381	4	47
α-helix	382-384	3
β-strand	386-389	4	47
β-strand	395-400	6	45
β-strand	410-414	5	47
β-strand	427-431	5	47
α-helix	432	1
β-strand	433-434	2	46
α-helix	435	1
α-helix	438-440	3
β-strand	444-449	6	48
β-strand	454	1	49
β-strand	459-467	9	48
α-helix	470-473	4
β-strand	478-485	8	50
β-strand	488-496	9	50
β-strand	503-509	7	48
α-helix	512-514	3
β-strand	517-526	10	50
β-strand	530-539	10	50
β-strand	540	1	49
α-helix	541	1
β-strand	548-551	4	51
β-strand	557	1	52
β-strand	562-569	8	51
β-strand	574-581	8	53
α-helix	582-587	6
α-helix	595-603	9
β-strand	612	1	50
α-helix	617-623	7
β-strand	626-630	5	37
β-strand	635	1	37
α-helix	636-639	4
β-strand	748	1	54
β-strand	754-761	8	53
β-strand	772-779	8	51
β-strand	786-794	9	53
β-strand	800-802	3	53
β-strand	804	1	51
β-strand	806-809	4	53
β-strand	810	1	52
β-strand	814-817	4	55
β-strand	824-825	2	54
β-strand	830-838	9	55
β-strand	844-850	7	54
α-helix	851-852	2
β-strand	856-858	3	55
β-strand	867-872	6	54
β-strand	876-886	11	55
β-strand	890-900	11	54
β-strand	906-916	11	54
β-strand	920-930	11	56
β-strand	940-945	6	57
β-strand	953	1	56
β-strand	959-968	10	56
β-strand	1275-1280	6	57
β-strand	1288-1292	5	57
β-strand	1301-1305	5	56
β-strand	1311-1317	7	57
β-strand	1320-1331	12	56
β-strand	1343-1350	8	58
β-strand	1362-1371	10	58
α-helix	1376	1
β-strand	1377-1385	9	59
α-helix	1386-1387	2
β-strand	1390-1392	3	58
β-strand	1393	1	60
α-helix	1394-1401	8
β-strand	1406-1407	2	59
β-strand	1413-1414	2	60
β-strand	1417-1418	2	60
β-strand	1422-1430	9	59
β-strand	1436-1444	9	58
β-strand	1454-1460	7	59
β-strand	1463-1472	10	59
β-strand	1473	1	61
β-strand	1476	1	61
α-helix	1480-1482	3
β-strand	1484-1486	3	62
β-strand	1489-1491	3	62
α-helix	1508-1515	8
β-strand	1522-1534	13	63
β-strand	1537-1549	13	63
β-strand	1561-1566	6	63
α-helix	1567-1569	3
α-helix	1570-1573	4
β-strand	1580-1585	6	63
α-helix	1587-1589	3
β-strand	1590-1591	2	63
β-strand	1597-1600	4	63
β-strand	1606-1609	4	63
α-helix	1615-1617	3
α-helix	1622-1636	15

Chain C: 39 helices, 122 β-strands

Element	Residues	Length	Sheet
β-strand	23-28	6	64
β-strand	31-32	2	65
β-strand	37-43	7	64
β-strand	52-57	6	66
β-strand	65-71	7	66
β-strand	81-85	5	64
β-strand	102-108	7	66
β-strand	112-117	6	66
β-strand	119-120	2	65
β-strand	125-130	6	67
β-strand	134-135	2	68
β-strand	140-148	9	67
β-strand	159-165	7	68
β-strand	169-176	8	68
β-strand	182-189	8	67
β-strand	197-205	9	68
β-strand	212-219	8	68
β-strand	221-222	2	69
β-strand	228-233	6	70
β-strand	237-238	2	71
α-helix	240-242	3
β-strand	246-253	8	70
β-strand	259	1	70
β-strand	262-263	2	70
β-strand	264-272	9	71
β-strand	281-282	2	71
β-strand	292-293	2	70
β-strand	296-301	6	70
α-helix	303-307	5
α-helix	309-311	3
α-helix	316-318	3
β-strand	322-330	9	71
β-strand	338-342	5	71
β-strand	346-347	2	71
β-strand	352-356	5	72
β-strand	362-363	2	73
β-strand	369-377	9	72
β-strand	382	1	72
β-strand	387-396	10	73
β-strand	401-410	10	73
β-strand	417-422	6	72
β-strand	428-437	10	73
β-strand	449-456	8	73
α-helix	457-458	2
β-strand	466-469	4	74
β-strand	478	1	75
β-strand	480	1	75
β-strand	481-487	7	74
β-strand	498-505	8	76
β-strand	508-516	9	76
β-strand	524-529	6	74
α-helix	532-534	3
β-strand	538-546	9	76
β-strand	553-561	9	76
β-strand	572-575	4	77
β-strand	582	1	78
β-strand	587-593	7	77
β-strand	599-601	3	79
β-strand	604-606	3	80
α-helix	607-610	4
α-helix	622-626	5
β-strand	637	1	76
α-helix	642-647	6
β-strand	651-653	3	64
α-helix	681-689	9
α-helix	698-701	4
α-helix	711-715	5
α-helix	722-738	17
β-strand	764-765	2	69
β-strand	773	1	80
β-strand	777-779	3	79
β-strand	783-789	7	77
β-strand	796-799	4	80
β-strand	802	1	81
β-strand	803	1	79
β-strand	805	1	82
β-strand	808	1	82
β-strand	811	1	81
β-strand	815-818	4	80
β-strand	819	1	78
β-strand	823-828	6	83
β-strand	833-834	2	84
β-strand	835	1	85
β-strand	837	1	85
β-strand	840-847	8	83
β-strand	853-859	7	86
β-strand	865-866	2	87
β-strand	874	1	88
β-strand	879	1	88
β-strand	886-888	3	86
β-strand	892-899	8	83
β-strand	901-902	2	87
β-strand	910-916	7	86
β-strand	919-925	7	86
β-strand	929-930	2	84
β-strand	935	1	89
β-strand	942-944	3	90
β-strand	945	1	91
β-strand	954	1	91
β-strand	956-959	4	92
β-strand	967	1	93
α-helix	968	1
β-strand	974-980	7	90
α-helix	985-992	8
α-helix	993-995	3
α-helix	1009-1013	5
α-helix	1016-1024	9
α-helix	1025-1029	5
α-helix	1031-1033	3
α-helix	1038-1057	20
β-strand	1060	1	94
β-strand	1066	1	94
β-strand	1067	1	95
β-strand	1074	1	95
α-helix	1076-1089	14
α-helix	1097-1110	14
β-strand	1112	1	96
β-strand	1118	1	96
α-helix	1133-1155	23
α-helix	1156-1158	3
α-helix	1162-1179	18
α-helix	1185-1196	12
α-helix	1203-1213	11
β-strand	1217-1219	3	97
β-strand	1225-1227	3	97
α-helix	1245-1261	17
α-helix	1264-1275	12
α-helix	1279	1
α-helix	1288-1303	16
α-helix	1306-1308	3
β-strand	1311-1317	7	92
β-strand	1322-1328	7	92
α-helix	1336-1338	3
β-strand	1339-1340	2	90
β-strand	1346-1350	5	92
β-strand	1357-1364	8	90
β-strand	1365	1	89
β-strand	1367	1	93
β-strand	1377-1384	8	98
β-strand	1400-1408	9	98
β-strand	1422-1425	4	99
α-helix	1427-1429	3
β-strand	1432-1434	3	98
α-helix	1436-1444	9
β-strand	1453-1456	4	99
β-strand	1459-1464	6	99
β-strand	1473-1481	9	98
β-strand	1491-1497	7	99
β-strand	1500-1509	10	99
α-helix	1542-1545	4
β-strand	1559-1571	13	100
β-strand	1574-1580	7	100
β-strand	1586	1	100
β-strand	1597-1601	5	100
α-helix	1611-1612	2
β-strand	1616-1621	6	100
β-strand	1626	1	101
β-strand	1635	1	101
β-strand	1636-1637	2	100
β-strand	1645-1647	3	100
α-helix	1657-1673	17

Chain D: 27 helices, 109 β-strands

Element	Residues	Length	Sheet
β-strand	24-30	7	102
β-strand	32-34	3	103
β-strand	39-40	2	104
β-strand	42-46	5	102
β-strand	52-60	9	103
β-strand	67-75	9	103
β-strand	82-83	2	102
β-strand	86-87	2	104
α-helix	91-93	3
β-strand	103-110	8	103
β-strand	113-122	10	103
β-strand	128-132	5	105
β-strand	136-137	2	106
β-strand	142-144	3	107
β-strand	145-149	5	105
β-strand	161-166	6	106
β-strand	172-178	7	106
β-strand	185-187	3	107
β-strand	195-203	9	106
β-strand	206-216	11	106
β-strand	224-230	7	108
β-strand	234-236	3	109
β-strand	243-251	9	108
β-strand	256	1	108
β-strand	259-269	11	109
β-strand	272-275	4	109
α-helix	277-279	3
β-strand	281-285	5	109
β-strand	286	1	108
β-strand	289-294	6	108
α-helix	296-302	7
α-helix	306-308	3
β-strand	312-322	11	109
β-strand	328-339	12	109
β-strand	345-346	2	110
β-strand	353-354	2	111
β-strand	360-366	7	110
β-strand	367	1	112
β-strand	373	1	112
β-strand	378-381	4	113
α-helix	382-384	3
β-strand	386-389	4	113
β-strand	395-400	6	110
β-strand	410-414	5	113
β-strand	427-431	5	113
α-helix	432	1
β-strand	433-434	2	111
α-helix	435	1
α-helix	438-440	3
β-strand	444-449	6	114
β-strand	454	1	115
β-strand	459-467	9	114
α-helix	470-473	4
β-strand	478-485	8	116
β-strand	488-496	9	116
β-strand	503-509	7	114
α-helix	512-514	3
β-strand	517-526	10	116
β-strand	530-539	10	116
β-strand	540	1	115
α-helix	541	1
β-strand	548-551	4	117
β-strand	557	1	118
β-strand	562-564	3	119
β-strand	566-569	4	117
β-strand	574-581	8	120
α-helix	582-587	6
α-helix	595-603	9
β-strand	612	1	116
α-helix	617-623	7
β-strand	626-630	5	102
β-strand	635	1	102
α-helix	636-639	4
α-helix	742-744	3
β-strand	748	1	121
β-strand	754-761	8	120
β-strand	772-774	3	117
β-strand	777-779	3	119
β-strand	786-794	9	120
β-strand	800-802	3	120
β-strand	804	1	117
β-strand	806-809	4	120
β-strand	810	1	118
β-strand	814-817	4	122
β-strand	824-825	2	121
β-strand	830-838	9	122
β-strand	844-850	7	121
α-helix	851-852	2
β-strand	856-858	3	122
β-strand	867-872	6	121
β-strand	876-886	11	122
β-strand	890-900	11	121
β-strand	906-916	11	121
β-strand	920-930	11	123
β-strand	940-945	6	124
β-strand	953	1	123
β-strand	959-968	10	123
β-strand	1275-1280	6	124
β-strand	1288-1292	5	124
β-strand	1301-1305	5	123
β-strand	1311-1317	7	124
β-strand	1320-1331	12	123
β-strand	1343-1350	8	125
β-strand	1362-1371	10	125
α-helix	1376	1
β-strand	1377-1385	9	126
α-helix	1386-1387	2
β-strand	1390-1392	3	125
β-strand	1393	1	127
α-helix	1394-1401	8
β-strand	1406-1407	2	126
β-strand	1413-1414	2	127
β-strand	1417-1418	2	127
β-strand	1422-1430	9	126
β-strand	1436-1444	9	125
β-strand	1454-1460	7	126
β-strand	1463-1472	10	126
β-strand	1473	1	128
β-strand	1476	1	128
α-helix	1480-1482	3
β-strand	1484-1486	3	129
β-strand	1489-1491	3	129
α-helix	1508-1515	8
β-strand	1522-1534	13	130
β-strand	1537-1549	13	130
β-strand	1561-1566	6	130
α-helix	1567-1569	3
α-helix	1570-1573	4
β-strand	1580-1585	6	130
α-helix	1587-1589	3
β-strand	1590-1591	2	130
β-strand	1597-1600	4	130
β-strand	1606-1607	2	130
β-strand	1610	1	130
α-helix	1615-1617	3
α-helix	1622-1636	15

Chains X and Y: 4 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	44-51	8
β-strand	54-60	7	131
β-strand	63	1	132
β-strand	83-85	3	133
β-strand	97	1	132
β-strand	101-106	6	131
β-strand	109-110	2	133
β-strand	116-119	4	133
β-strand	122-123	2	131
β-strand	132-142	11	12
β-strand	145-155	11	12
β-strand	159-161	3	134
α-helix	162-176	15
β-strand	186-194	9	12
β-strand	197-199	3	12
β-strand	202	1	12
α-helix	209-213	5
β-strand	215-217	3	134
α-helix	218-220	3
β-strand	223-229	7	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C5	A, C	protein	1676	Homo sapiens	P01031 (AlphaFold model)
Cobra venom factor	B, D	protein	1642	Naja kaouthia	Q91132 (AlphaFold model)
Superantigen-like protein 7	X, Y	protein	231	Staphylococcus aureus	D3JIB2 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>3PRX_1 Complement C5 (chains A, C)
MGLLGILCFLIFLGKTWGQEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYP
DKKFSYSSGHVHLSSENKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPIT
YDNGFLFIHTDKPVYTPDQSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHI
GIISFPDFKIPSNPRYGMWTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGY
KNFKNFEITIKARYFYNKVVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVT
FDSETAVKELSYYSLEDLNNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATP
LFLKPGIPYPIKVQVKDSLDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASF
VLNLPSGVTVLEFNVKTDAPDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGE
HLNIIVTPKSPYIDKITHYNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRL
LVYYIVTGEQTAELVSDSVWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWV
ALAAVDSAVYGVQRGAKKPLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANAD
DSQENDEPCKEILRPRRTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISL
GPRCIKAFTECCVVASQLRANISHKDMQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLV
PRRKQLQFALPDSLTTWEIQGVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQ
LKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTV
LPLEIGLHNINFSLETWFGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFP
YRIPLDLVPKTEIKRILSVKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFY
VFHYLETGNHWNIFHSDPLIEKQKLKKKLKEGMLSIMSYRNADYSYSVWKGGSASTWLTA
FALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEAREN
SLYLTAFTVIGIRKAFDICPLVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDK
THPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLN
LKDINYVNPVIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHK
GALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLK
IDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLK
ALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHR
PDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYA
YKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIM
GKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC

Sequence of entity 2 (B, D), FASTA

>3PRX_2 Cobra venom factor (chains B, D)
MERMALYLVAALLIGFPGSSHGALYTLITPAVLRTDTEEQILVEAHGDSTPKQLDIFVHD
FPRKQKTLFQTRVDMNPAGGMLVTPTIEIPAKEVSTDSRQNQYVVVQVTGPQVRLEKVVL
LSYQSSFLFIQTDKGIYTPGSPVLYRVFSMDHNTSKMNKTVIVEFQTPEGILVSSNSVDL
NFFWPYNLPDLVSLGTWRIVAKYEHSPENYTAYFDVRKYVLPSFEVRLQPSEKFFYIDGN
ENFHVSITARYLYGEEVEGVAFVLFGVKIDDAKKSIPDSLTRIPIIDGDGKATLKRDTFR
SRFPNLNELVGHTLYASVTVMTESGSDMVVTEQSGIHIVASPYQIHFTKTPKYFKPGMPY
ELTVYVTNPDGSPAAHVPVVSEAFHSMGTTLSDGTAKLILNIPLNAQSLPITVRTNHGDL
PRERQATKSMTAIAYQTQGGSGNYLHVAITSTEIKPGDNLPVNFNVKGNANSLKQIKYFT
YLILNKGKIFKVGRQPRRDGQNLVTMNLHITPDLIPSFRFVAYYQVGNNEIVADSVWVDV
KDTCMGTLVVKGDNLIQMPGAAMKIKLEGDPGARVGLVAVDKAVYVLNDKYKISQAKIWD
TIEKSDFGCTAGSGQNNLGVFEDAGLALTTSTNLNTKQRSAAKCPQPANRRRRSSVLLLD
SNASKAAEFQDQDLRKCCEDVMHENPMGYTCEKRAKYIQEGDACKAAFLECCRYIKGVRD
ENQRESELFLARDDNEDGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYL
RDSITTWVVLAVSFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYV
NEDIYVRVELLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASV
QEALWSDGVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIE
TKIIIQGDPVAQIIENSIDGSKLNHLIITPSGCGEQNMIRMAAPVIATYYLDTTEQWETL
GINRRTEAVNQIVTGYAQQMVYKKADHSYAAFTNRASSSWLTAYVVKVFAMAAKMVAGIS
HEIICGGVRWLILNRQQPDGAFKENAPVLSGTMQGGIQGAEEEVYLTAFILVALLESKTI
CNDYVNSLDSSIKKATNYLLKKYEKLQRPYTTALTAYALAAADQLNDDRVLMAASTGRDH
WEEYNAHTHNIEGTSYALLALLKMKKFDQTGPIVRWLTDQNFYGETYGQTQATVMAFQAL
AEYEIQMPTHKDLNLDITIELPDREVPIRYRINYENALLARTVETKLNQDITVTASGDGK
ATMTILTFYNAQLQEKANVCNKFHLNVSVENIHLNAMGAKGALMLKICTRYLGEVDSTMT
IIDISMLTGFLPDAEDLTRLSKGVDRYISRYEVDNNMAQKVAVIIYLNKVSHSEDECLHF
KILKHFEVGFIQPGSVKVYSYYNLDEKCTKFYHPDKGTGLLNKICIGNVCRCAGETCSSL
NHQERIDVPLQIEKACETNVDYVYKTKLLRIEEQDGNDIYVMDVLEVIKQGTDENPRAKT
HQYISQRKCQEALNLKVNDDYLIWGSRSDLLPTKDKISYIITKNTWIERWPHEDECQEEE
FQKLCDDFAQFSYTLTEFGCPT

Sequence of entity 3 (X, Y), FASTA

>3PRX_3 Superantigen-like protein 7 (chains X, Y)
MKLKTLAKATLALGLLTTGVITSEGQAVQAAEKQGRVQHLHDIRDLHRYYSSESFEYSNV
SGKVENYNGSNVVRFNPKDQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVG
GVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLY
KGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQI

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Substrate recognition by complement convertases revealed in the C5-cobra venom factor complex. Laursen, N.S., Andersen, K.R., Braren, I. et al. EMBO J (2011) 30:606-616. DOI 10.1038/emboj.2010.341 · PubMed

Other PDB entries of the same protein (UniProt P01031 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y6C 2.0 Å, X-ray structure analysis of human Complement Component 5 TE domain in complex with the…
5B71 2.11 Å, Crystal structure of complement C5 in complex with SKY59
4UU9 2.12 Å, Crystal structure of the human c5a in complex with MEDI7814 a neutralising antibody
7AD7 2.3 Å, Crystal structure of human complement C5 in complex with the K8 bovine knob domain…
5B4P 2.4 Å, Complex structure of human C5a and its binding repebody
4P39 2.4 Å, Crystal structure of the human C5aR antagonist C5a-A8
7OP0 2.57 Å, Crystal structure of complement C5 in complex with chemically synthesized K92 knob domain.
3HQA 2.59 Å, Crystal structure of human desarg-C5A
5HCC 2.59 Å, Ternary complex of human Complement C5 with Ornithodoros moubata OmCI and Dermacentor…
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
6RPT 2.7 Å, Structure of tick complement inhibitor CirpT1 complexed with macroglobubulin domain 4 of…
7AD6 2.75 Å, Crystal structure of human complement C5 in complex with the K92 bovine knob domain…

Browse structure collections

About this viewer

MolViewer shows 3PRX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.