Glycosylated SV2 and Gangliosides as Dual Receptors for Botulinum Neurotoxin Serotype F. Determined by X-ray diffraction at 2.1 Å resolution. Released 16 Jun 2009.
Explore 3FUQ in 3D Show helices and sheets RCSB PDB PDBe
3FUQ contains 7 α-helices and 41 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 872-873 | 2 | 1 |
| β-strand | 874-877 | 4 | 2 |
| β-strand | 880-883 | 4 | 2 |
| β-strand | 890-895 | 6 | 3 |
| β-strand | 898-899 | 2 | 1 |
| β-strand | 906-910 | 5 | 1 |
| β-strand | 915-920 | 6 | 3 |
| α-helix | 923-925 | 3 | |
| β-strand | 934-941 | 8 | 1 |
| α-helix | 943-945 | 3 | |
| α-helix | 948-950 | 3 | |
| β-strand | 955-961 | 7 | 3 |
| β-strand | 967-973 | 7 | 3 |
| β-strand | 976-982 | 7 | 3 |
| β-strand | 988-994 | 7 | 3 |
| β-strand | 998 | 1 | 4 |
| β-strand | 1008-1015 | 8 | 1 |
| β-strand | 1020-1025 | 6 | 1 |
| β-strand | 1028-1034 | 7 | 1 |
| β-strand | 1046-1052 | 7 | 3 |
| β-strand | 1059-1068 | 10 | 1 |
| α-helix | 1074-1083 | 10 | |
| β-strand | 1089 | 1 | 5 |
| β-strand | 1091 | 1 | 6 |
| β-strand | 1097 | 1 | 6 |
| α-helix | 1098 | 1 | |
| β-strand | 1099 | 1 | 7 |
| β-strand | 1104-1108 | 5 | 8 |
| β-strand | 1114-1118 | 5 | 9 |
| β-strand | 1123-1128 | 6 | 9 |
| α-helix | 1129 | 1 | |
| β-strand | 1131-1134 | 4 | 4 |
| β-strand | 1138-1141 | 4 | 4 |
| β-strand | 1148-1153 | 6 | 8 |
| β-strand | 1165 | 1 | 7 |
| β-strand | 1167 | 1 | 5 |
| β-strand | 1171-1178 | 8 | 8 |
| β-strand | 1181-1187 | 7 | 8 |
| β-strand | 1195-1202 | 8 | 8 |
| β-strand | 1212-1219 | 8 | 8 |
| β-strand | 1222-1229 | 8 | 8 |
| β-strand | 1234-1240 | 7 | 8 |
| β-strand | 1244 | 1 | 9 |
| β-strand | 1245-1248 | 4 | 8 |
| α-helix | 1249-1253 | 5 | |
| β-strand | 1266-1269 | 4 | 8 |
| β-strand | 1272 | 1 | 10 |
| β-strand | 1275 | 1 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| BoNT/F (Neurotoxin type F) | A | protein | 417 | Clostridium botulinum | A7GBG3 (AlphaFold model) |
>3FUQ_1 BoNT/F (Neurotoxin type F) (chains A) LYKKIKDNSILDMRYENNKFIDISGYGSNISINGDVYIYSTNRNQFGIYSSKPSEVNIAQ NNDIIYNGRYQNFSISFWVRIPKYFNKVNLNNEYTIIDCIRNNNSGWKISLNYNKIIWTL QDTAGNNQKLVFNYTQMISISDYINKWIFVTITNNRLGNSRIYINGNLIDEKSISNLGDI HVSDNILFKIVGCNDTRYVGIRYFKVFDTELGKTEIETLYSDEPDPSILKDFWGNYLLYN KRYYLLNLLRTDKSITQNSNFLNINQQRGVYQKPNIFSNTRLYTGVEVIIRKNGSTDISN TDNFVRKNDLAYINVVDRDVEYRLYADISIAKPEKIIKLIRTSNSNNSLGQIIVMDSIGN NCTMNFQNNNGGNIGLLGFHSNNLVASSWYYNNIRKNTSSNGCFWSFISKEHGWQEN
Glycosylated SV2 and gangliosides as dual receptors for botulinum neurotoxin serotype F. Fu, Z., Chen, C., Barbieri, J.T. et al. Biochemistry (2009) 48:5631-5641. DOI 10.1021/bi9002138 · PubMed
Other PDB entries of the same protein (UniProt A7GBG3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3FUQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.