Design and Preparation of Potent, Non-Peptidic, Bioavailable Renin Inhibitors. Determined by X-ray diffraction at 1.9 Å resolution. Released 30 Jun 2009.
Explore 3G72 in 3D Show helices and sheets RCSB PDB PDBe
3G72 contains 29 α-helices and 64 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6 | 1 | 1 |
| β-strand | 8-12 | 5 | 2 |
| β-strand | 13-15 | 3 | 3 |
| β-strand | 19-21 | 3 | 3 |
| β-strand | 22-26 | 5 | 4 |
| β-strand | 31-38 | 8 | 4 |
| β-strand | 44-47 | 4 | 4 |
| β-strand | 48 | 1 | 5 |
| α-helix | 56-59 | 4 | |
| β-strand | 64 | 1 | 5 |
| α-helix | 66-68 | 3 | |
| β-strand | 73-83 | 11 | 4 |
| β-strand | 86-99 | 14 | 4 |
| β-strand | 102-113 | 12 | 4 |
| α-helix | 119-121 | 3 | |
| β-strand | 126-129 | 4 | 4 |
| α-helix | 133-135 | 3 | |
| α-helix | 137-139 | 3 | |
| α-helix | 140-142 | 3 | |
| α-helix | 143-148 | 6 | |
| β-strand | 153 | 1 | 1 |
| β-strand | 157-162 | 6 | 2 |
| β-strand | 174-178 | 5 | 2 |
| α-helix | 183-185 | 3 | |
| β-strand | 186-194 | 9 | 2 |
| β-strand | 195 | 1 | 6 |
| β-strand | 202-210 | 9 | 6 |
| β-strand | 213-216 | 4 | 6 |
| β-strand | 221-225 | 5 | 6 |
| β-strand | 232-234 | 3 | 6 |
| α-helix | 236-246 | 11 | |
| β-strand | 249-250 | 2 | 7 |
| β-strand | 255-258 | 4 | 7 |
| α-helix | 259-264 | 6 | |
| α-helix | 266-267 | 2 | |
| β-strand | 268-272 | 5 | 6 |
| β-strand | 275-279 | 5 | 6 |
| α-helix | 281-284 | 4 | |
| β-strand | 285 | 1 | 8 |
| β-strand | 295-297 | 3 | 7 |
| β-strand | 298 | 1 | 8 |
| β-strand | 300-302 | 3 | 6 |
| α-helix | 305-306 | 2 | |
| β-strand | 313-315 | 3 | 6 |
| α-helix | 317-322 | 6 | |
| β-strand | 323-328 | 6 | 2 |
| β-strand | 333-339 | 7 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-12 | 5 | 9 |
| β-strand | 13-15 | 3 | 10 |
| β-strand | 19-21 | 3 | 10 |
| β-strand | 22-26 | 5 | 11 |
| β-strand | 31-38 | 8 | 11 |
| β-strand | 44-47 | 4 | 11 |
| β-strand | 48 | 1 | 12 |
| α-helix | 56-59 | 4 | |
| β-strand | 64 | 1 | 12 |
| α-helix | 66-68 | 3 | |
| β-strand | 73-83 | 11 | 11 |
| β-strand | 86-99 | 14 | 11 |
| β-strand | 102-113 | 12 | 11 |
| α-helix | 119-121 | 3 | |
| β-strand | 126-129 | 4 | 11 |
| α-helix | 133-135 | 3 | |
| α-helix | 137-139 | 3 | |
| α-helix | 140-142 | 3 | |
| α-helix | 143-149 | 7 | |
| β-strand | 157-162 | 6 | 9 |
| α-helix | 163-165 | 3 | |
| β-strand | 174-178 | 5 | 9 |
| α-helix | 183-185 | 3 | |
| β-strand | 186-194 | 9 | 9 |
| β-strand | 202-205 | 4 | 13 |
| β-strand | 208-210 | 3 | 14 |
| β-strand | 213-216 | 4 | 14 |
| β-strand | 221-225 | 5 | 13 |
| β-strand | 232-234 | 3 | 13 |
| α-helix | 236-246 | 11 | |
| β-strand | 249-250 | 2 | 15 |
| β-strand | 255-258 | 4 | 15 |
| α-helix | 262-264 | 3 | |
| α-helix | 266-267 | 2 | |
| β-strand | 268-272 | 5 | 14 |
| β-strand | 275-279 | 5 | 14 |
| α-helix | 281-284 | 4 | |
| β-strand | 285 | 1 | 16 |
| β-strand | 295-297 | 3 | 15 |
| β-strand | 298 | 1 | 16 |
| β-strand | 300-302 | 3 | 13 |
| α-helix | 305-306 | 2 | |
| β-strand | 313-315 | 3 | 13 |
| α-helix | 317-322 | 6 | |
| β-strand | 323-328 | 6 | 9 |
| β-strand | 333-339 | 7 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Renin | A, B | protein | 340 | Homo sapiens | P00797 (AlphaFold model) |
>3G72_1 Renin (chains A, B) LTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVY HKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFM LAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGG SDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIE KLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAI HAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
| ID | Name | Formula | Copies |
|---|---|---|---|
| A6T | (1S,5R)-7-{4-[3-(2-chloro-3,6-difluorophenoxy)propyl]phenyl}-N-cyclopropyl-N-(2… | C33 H32 Cl3 F2 N3 O2 | 2 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Water and common crystallization additives (DMS) are not listed.
Design and Preparation of Potent, Nonpeptidic, Bioavailable Renin Inhibitors. Bezencon, O., Bur, D., Weller, T. et al. J Med Chem (2009) 52:3689-3702. DOI 10.1021/jm900022f · PubMed
Other PDB entries of the same protein (UniProt P00797 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3G72 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.