3GA4: Ost6L

Name: PDB 3GA4: Crystal structure of Ost6L (photoreduced form)
Published: 2009-06-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Crystal structure of Ost6L (photoreduced form). Determined by X-ray diffraction at 1.3 Å resolution. Released 16 Jun 2009.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,633
Mol. weight: 20.79 kDa
Released: 16 Jun 2009

Explore 3GA4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GA4 contains 9 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
β-strand	19-21	3	1
α-helix	22	1
α-helix	27-31	5
β-strand	38-44	7	1
β-strand	48	1	2
β-strand	54	1	2
α-helix	56-75	20
β-strand	81-87	7	1
α-helix	92-97	6
β-strand	105-109	5	1
α-helix	110-113	4
α-helix	114-119	6
β-strand	128-130	3	1
α-helix	134-136	3
α-helix	140-151	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6	A	protein	178	Saccharomyces cerevisiae	Q03723 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3GA4_1 Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6 (chains A)
MATASHNIDDILQLKDDTGVITVTADNYPLLSRGVPGYFNILYITMRGTNSNGMSCQLCH
DFEKTYHAVADVIRSQAPQSLNLFFTVDVNEVPQLVKDLKLQNVPHLVVYPPAESNKQSQ
FEWKTSPFYQYSLVPENAENTLQFGDFLAKILNISITVPQAFNVQEEFHHHHHHHHHH

Primary citation

Oxidoreductase activity of oligosaccharyltransferase subunits Ost3p and Ost6p defines site-specific glycosylation efficiency. Schulz, B.L., Stirnimann, C.U., Grimshaw, J.P. et al. Proc Natl Acad Sci U S A (2009) 106:11061-11066. DOI 10.1073/pnas.0812515106 · PubMed

Other PDB entries of the same protein (UniProt Q03723 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3G9B 1.96 Å, Crystal structure of reduced Ost6L
3G7Y 2.21 Å, Crystal structure of oxidized Ost6L
7OCI 3.46 Å, Cryo-EM structure of yeast Ost6p containing oligosaccharyltransferase complex

Browse structure collections

About this viewer

MolViewer shows 3GA4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.