3GC3: Arrestin2S and Clathrin

Crystal Structure of Arrestin2S and Clathrin. Determined by X-ray diffraction at 2.2 Å resolution. Released 25 Aug 2009.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Bos taurus
Chains: 2
Atoms: 5,587
Mol. weight: 83.95 kDa
Released: 25 Aug 2009

Explore 3GC3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GC3 contains 17 α-helices and 56 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	19-22	4	1
β-strand	26-29	4	2
β-strand	34	1	2
β-strand	37-42	6	1
β-strand	52-63	12	3
β-strand	75-87	13	3
α-helix	96-98	3
α-helix	99-106	8
β-strand	112-117	6	1
α-helix	124-126	3
β-strand	127-129	3	3
β-strand	140-151	12	3
β-strand	164-168	5	3
β-strand	169-172	4	2
α-helix	175-178	4
β-strand	183-189	7	4
β-strand	196-203	8	4
β-strand	207-209	3	5
β-strand	214-222	9	4
β-strand	228-241	14	6
β-strand	247-258	12	6
β-strand	262	1	6
β-strand	266-274	9	4
β-strand	288-289	2	3
β-strand	300	1	3
α-helix	301-305	5
β-strand	317-329	13	6
β-strand	335-341	7	6
β-strand	342-344	3	5
α-helix	345-348	4
β-strand	370	1	7
β-strand	379-382	4	1

Chain B: 11 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	8
α-helix	15-18	4
α-helix	22-24	3
β-strand	30-34	5	9
β-strand	37-42	6	9
β-strand	49-54	6	9
β-strand	62-65	4	9
β-strand	66	1	7
β-strand	70-73	4	10
β-strand	79-84	6	10
β-strand	87-92	6	10
β-strand	97-103	7	10
β-strand	108-113	6	11
β-strand	118-123	6	11
β-strand	126-131	6	11
α-helix	136-138	3
β-strand	139-143	5	11
α-helix	144-145	2
α-helix	146-148	3
α-helix	151	1
β-strand	152-158	7	12
β-strand	164-172	9	12
β-strand	177-185	9	12
β-strand	190-194	5	12
β-strand	198-204	7	13
β-strand	213-222	10	13
β-strand	225-232	8	13
α-helix	241-245	5
β-strand	246-249	4	13
β-strand	261-267	7	14
β-strand	272-277	6	14
β-strand	281-286	6	14
β-strand	292-297	6	14
β-strand	303-309	7	8
α-helix	310-312	3
β-strand	314-319	6	8
β-strand	323-329	7	8
α-helix	334-336	3
α-helix	337-341	5
α-helix	345-355	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A	protein	385	Bos taurus	P17870 (AlphaFold model)
Clathrin heavy chain 1	B	protein	363	Bos taurus	P49951 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3GC3_1 Beta-arrestin-1 (chains A)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGDVAVELPFTLMHPKPKEEPPHREVPEH
ETPVDTNLIELDTNDDDIVFEDFAR

Sequence of entity 2 (B), FASTA

>3GC3_2 Clathrin heavy chain 1 (chains B)
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EEL

Primary citation

Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking. Kang, D.S., Kern, R.C., Puthenveedu, M.A. et al. J Biol Chem (2009) 284:29860-29872. DOI 10.1074/jbc.M109.023366 · PubMed

Other PDB entries of the same protein (UniProt P17870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1G4M 1.9 Å, Crystal structure of bovine beta-arrestin 1
1G4R 2.2 Å, Crystal structure of bovine beta-arrestin 1
7DFC 2.49 Å, Crystal of Arrestin2-V2Rpp-3-Fab30 complex
7DFA 2.54 Å, Crystal of Arrestin2-V2Rpp-4-Fab30 complex
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
9WSV 2.8 Å, Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex
9WSX 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex
22GK 2.84 Å, C5a bound C5aR2 in complex with beta-arrestin1
1JSY 2.9 Å, Crystal structure of bovine arrestin-2
1ZSH 2.9 Å, Crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (IP6)
22CR 2.9 Å, C5a-desArg bound C5aR2 in complex with beta-arrestin1
2WTR 2.9 Å, Full length Arrestin2

Browse structure collections

About this viewer

MolViewer shows 3GC3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.