Mammalian Clock Protein mPER2 - Crystal Structure of a PAS Domain Fragment. Determined by X-ray diffraction at 2.4 Å resolution. Released 19 May 2009.
Explore 3GDI in 3D Show helices and sheets RCSB PDB PDBe
3GDI contains 21 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 170 | 1 | 1 |
| β-strand | 190-195 | 6 | 1 |
| β-strand | 201 | 1 | 2 |
| β-strand | 202-205 | 4 | 1 |
| β-strand | 224 | 1 | 2 |
| α-helix | 225-228 | 4 | |
| β-strand | 229 | 1 | 1 |
| α-helix | 234-240 | 7 | |
| β-strand | 248 | 1 | 1 |
| β-strand | 268-272 | 5 | 1 |
| β-strand | 285-295 | 11 | 1 |
| β-strand | 306-314 | 9 | 1 |
| α-helix | 323-325 | 3 | |
| α-helix | 326-328 | 3 | |
| β-strand | 330-335 | 6 | 3 |
| β-strand | 340 | 1 | 4 |
| β-strand | 341-344 | 4 | 3 |
| α-helix | 348-352 | 5 | |
| α-helix | 356-359 | 4 | |
| β-strand | 363 | 1 | 4 |
| α-helix | 364-367 | 4 | |
| β-strand | 368 | 1 | 3 |
| α-helix | 373-385 | 13 | |
| β-strand | 391-399 | 9 | 3 |
| β-strand | 405-416 | 12 | 3 |
| β-strand | 423-434 | 12 | 3 |
| α-helix | 444-445 | 2 | |
| α-helix | 455-467 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 192-196 | 5 | 5 |
| β-strand | 201-204 | 4 | 5 |
| α-helix | 225-227 | 3 | |
| β-strand | 229 | 1 | 6 |
| α-helix | 231-233 | 3 | |
| α-helix | 234-240 | 7 | |
| β-strand | 268-273 | 6 | 6 |
| β-strand | 284-289 | 6 | 6 |
| β-strand | 290-294 | 5 | 5 |
| β-strand | 307-311 | 5 | 5 |
| β-strand | 314 | 1 | 6 |
| α-helix | 315-317 | 3 | |
| α-helix | 326-328 | 3 | |
| β-strand | 330-335 | 6 | 7 |
| β-strand | 340 | 1 | 8 |
| β-strand | 341-344 | 4 | 7 |
| α-helix | 348-352 | 5 | |
| α-helix | 356-359 | 4 | |
| β-strand | 363 | 1 | 8 |
| α-helix | 365-367 | 3 | |
| β-strand | 368 | 1 | 7 |
| α-helix | 375-386 | 12 | |
| β-strand | 391-399 | 9 | 7 |
| β-strand | 405-416 | 12 | 7 |
| β-strand | 423-434 | 12 | 7 |
| α-helix | 444-445 | 2 | |
| α-helix | 456-467 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Period circadian protein homolog 2 | A, B | protein | 309 | Mus musculus | O54943 (AlphaFold model) |
>3GDI_1 Period circadian protein homolog 2 (chains A, B) GPLGSSYSMEQVEGITSEYIVKNADMFAVAVSLVSGKILYISNQVASIFHCKKDAFSDAK FVEFLAPHDVSVFHSYTTPYKLPPWSVCSGLDSFTQECMEEKSFFCRVSVGKHHENEIRY QPFRMTPYLVKVQEQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQAV DERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQAGGQPFDYSPIRFRTRNGE YITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAPPCPEEKTPHPSVQELTEQI HRLLMQPVP
Structural and functional analyses of PAS domain interactions of the clock proteins Drosophila PERIOD and mouse PERIOD2. Hennig, S., Strauss, H.M., Vanselow, K. et al. PLoS Biol (2009) 7:e94-e94. DOI 10.1371/journal.pbio.1000094 · PubMed
Other PDB entries of the same protein (UniProt O54943 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3GDI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.