4U8H: Mammalian Period-Cryptochrome Complex

Crystal Structure of Mammalian Period-Cryptochrome Complex. Determined by X-ray diffraction at 2.8 Å resolution. Released 1 Oct 2014.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Mus musculus
Chains: 4
Atoms: 9,342
Mol. weight: 144.74 kDa
Ligands: ZN
Released: 1 Oct 2014

Explore 4U8H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4U8H contains 79 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 33 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	23-27	5	1
α-helix	37-44	8
β-strand	50-55	6	1
α-helix	67-85	19
β-strand	91-95	5	1
α-helix	101-109	9
β-strand	113-117	5	1
α-helix	122-136	15
β-strand	141-145	5	1
α-helix	153-158	6
α-helix	168-176	9
α-helix	182-185	4
α-helix	204-208	5
α-helix	209-211	3
α-helix	232-242	11
α-helix	245-248	4
α-helix	249-253	5
α-helix	259-262	4
α-helix	270-275	6
α-helix	280-295	16
α-helix	302-305	4
α-helix	306-318	13
α-helix	334-335	2
α-helix	338	1
β-strand	339	1	2
α-helix	340	1
α-helix	342-350	9
α-helix	356-368	13
α-helix	373-383	11
β-strand	390	1	2
α-helix	392-402	11
α-helix	408-419	12
α-helix	429-432	4
α-helix	435-440	6
α-helix	445-450	6
α-helix	452-454	3
α-helix	459-462	4
α-helix	470-474	5
β-strand	480	1	3
β-strand	484	1	3
α-helix	485-487	3
α-helix	491-507	17

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	1138-1141	4
α-helix	1147-1152	6
α-helix	1160-1174	15
α-helix	1183-1186	4
α-helix	1188-1192	5
α-helix	1202-1204	3

Chain C: 33 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	22-27	6	4
α-helix	37-42	6
β-strand	48-55	8	4
α-helix	67-85	19
β-strand	91-95	5	4
α-helix	98-107	10
β-strand	113-116	4	4
α-helix	122-136	15
α-helix	137-139	3
β-strand	141-142	2	4
α-helix	153-158	6
α-helix	168-177	10
α-helix	182-187	6
α-helix	190-194	5
α-helix	204-208	5
α-helix	209-212	4
α-helix	214-216	3
α-helix	224-226	3
α-helix	232-242	11
α-helix	245-248	4
α-helix	249-253	5
α-helix	259-262	4
α-helix	270-275	6
α-helix	280-295	16
α-helix	302-305	4
α-helix	306-318	13
α-helix	334-335	2
β-strand	339	1	5
α-helix	342-350	9
α-helix	356-368	13
α-helix	373-383	11
β-strand	390	1	5
α-helix	392-402	11
α-helix	408-419	12
α-helix	429-432	4
α-helix	435-440	6
α-helix	445-450	6
α-helix	452-454	3
α-helix	472-475	4
β-strand	480	1	6
β-strand	484	1	6
α-helix	492-507	16

Chain D: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	1134-1137	4
α-helix	1138-1141	4
α-helix	1147-1152	6
α-helix	1155-1157	3
α-helix	1160-1174	15
α-helix	1186-1192	7
α-helix	1202-1205	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cryptochrome-2	A, C	protein	510	Mus musculus	Q9R194 (AlphaFold model)
Period circadian protein homolog 2	B, D	protein	121	Mus musculus	O54943 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4U8H_1 Cryptochrome-2 (chains A, C)
MAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFA
ASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDS
EPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMEL
PKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLD
KHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTP
PLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDA
IMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSC
SAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCII
GVDYPRPIVNHAETSRLNIERMKQIYQQLS

Sequence of entity 2 (B, D), FASTA

>4U8H_2 Period circadian protein homolog 2 (chains B, D)
SSDTSHTSKYFGSIDSSENNHKAKMIPDTEESEQFIKYVLQDPIWLLMANTDDSIMMTYQ
LPSRDLQAVLKEDQEKLKLLQRSQPRFTEGQRRELREVHPWVHTGGLPTAIDVTGCVYCE
S

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Molecular assembly of the period-cryptochrome circadian transcriptional repressor complex. Nangle, S.N., Rosensweig, C., Koike, N. et al. Elife (2014) 3:e03674-e03674. DOI 10.7554/eLife.03674 · PubMed

Other PDB entries of the same protein (UniProt Q9R194 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7V8Y 1.9 Å, Crystal structure of mouse CRY2 in complex with SHP1703 compound
4MLP 1.94 Å, Mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase
7V8Z 1.95 Å, Crystal structure of mouse CRY2 in complex with SHP656 compound
4I6G 2.2 Å, a vertebrate cryptochrome with FAD
6KX8 2.25 Å, Crystal structure of mouse Cryptochrome 2 in complex with TH301 compound
7EJ9 2.6 Å, Alternative crystal structure of mouse Cryptochrome 2 in complex with TH301 compound
4I6E 2.7 Å, A vertebrate cryptochrome
4I6J 2.7 Å, A ubiquitin ligase-substrate complex
7D0N 2.8 Å, Crystal structure of mouse CRY2 apo form

Browse structure collections

About this viewer

MolViewer shows 4U8H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.