3GLF: Ecoli Clamp Loader
Crystal Structure of the Ecoli Clamp Loader Bound to Primer-Template DNA. Determined by X-ray diffraction at 3.39 Å resolution. Released 26 May 2009.
- Method
- X-ray diffraction
- Resolution
- 3.39 Å
- Organism
- Escherichia coli
- Chains
- 14
- Atoms
- 28,758
- Mol. weight
- 434.03 kDa
- Ligands
- BEF, ZN, MG, ADP
- Released
- 26 May 2009
Explore 3GLF in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3GLF contains 228 α-helices and 78 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 18 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-4 | 3 | 1 |
| α-helix | 6-12 | 7 | |
| β-strand | 20-25 | 6 | 1 |
| α-helix | 28-43 | 16 | |
| β-strand | 49-51 | 3 | 1 |
| β-strand | 54 | 1 | 1 |
| β-strand | 78-83 | 6 | 1 |
| α-helix | 93-100 | 8 | |
| β-strand | 108-114 | 7 | 1 |
| α-helix | 115-118 | 4 | |
| α-helix | 119-122 | 4 | |
| α-helix | 126-129 | 4 | |
| β-strand | 134-139 | 6 | 1 |
| α-helix | 140-142 | 3 | |
| α-helix | 147-157 | 11 | |
| β-strand | 161-162 | 2 | 2 |
| α-helix | 164-174 | 11 | |
| α-helix | 178-191 | 14 | |
| β-strand | 196-197 | 2 | 2 |
| α-helix | 199-203 | 5 | |
| α-helix | 214-223 | 10 | |
| α-helix | 226-238 | 13 | |
| α-helix | 243-263 | 21 | |
| α-helix | 269-276 | 8 | |
| α-helix | 282-292 | 11 | |
| α-helix | 297-313 | 17 | |
| α-helix | 320-330 | 11 | |
Chain B: 24 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 22-33 | 12 | |
| β-strand | 40-44 | 5 | 3 |
| α-helix | 51-63 | 13 | |
| α-helix | 77-84 | 8 | |
| β-strand | 90-94 | 5 | 3 |
| α-helix | 101-107 | 7 | |
| α-helix | 108-110 | 3 | |
| α-helix | 114-115 | 2 | |
| β-strand | 121-126 | 6 | 3 |
| α-helix | 128-130 | 3 | |
| α-helix | 133-144 | 12 | |
| β-strand | 150-155 | 6 | 3 |
| α-helix | 159-161 | 3 | |
| α-helix | 164-167 | 4 | |
| β-strand | 171-174 | 4 | 3 |
| α-helix | 175-179 | 5 | |
| α-helix | 180-193 | 14 | |
| β-strand | 197-198 | 2 | 4 |
| α-helix | 200-209 | 10 | |
| α-helix | 214-227 | 14 | |
| β-strand | 231-232 | 2 | 4 |
| α-helix | 234-243 | 10 | |
| α-helix | 248-257 | 10 | |
| α-helix | 261-274 | 14 | |
| α-helix | 278-294 | 17 | |
| α-helix | 299-301 | 3 | |
| α-helix | 307-318 | 12 | |
| α-helix | 322-338 | 17 | |
| α-helix | 345-358 | 14 | |
| α-helix | 364-367 | 4 | |
Chain C: 24 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 15-17 | 3 | |
| α-helix | 22-33 | 12 | |
| β-strand | 40-44 | 5 | 5 |
| α-helix | 51-63 | 13 | |
| α-helix | 77-83 | 7 | |
| β-strand | 90-94 | 5 | 5 |
| α-helix | 101-109 | 9 | |
| α-helix | 114-115 | 2 | |
| β-strand | 121-126 | 6 | 5 |
| α-helix | 128-130 | 3 | |
| α-helix | 133-144 | 12 | |
| β-strand | 150-156 | 7 | 5 |
| α-helix | 164-167 | 4 | |
| β-strand | 171-174 | 4 | 5 |
| α-helix | 175-179 | 5 | |
| α-helix | 180-193 | 14 | |
| β-strand | 198 | 1 | 6 |
| α-helix | 200-209 | 10 | |
| α-helix | 214-228 | 15 | |
| β-strand | 232 | 1 | 6 |
| α-helix | 234-241 | 8 | |
| α-helix | 243-245 | 3 | |
| α-helix | 247-257 | 11 | |
| α-helix | 261-273 | 13 | |
| α-helix | 278-297 | 20 | |
| α-helix | 299-301 | 3 | |
| α-helix | 310-319 | 10 | |
| α-helix | 322-338 | 17 | |
| α-helix | 345-358 | 14 | |
| α-helix | 364-367 | 4 | |
Chain D: 26 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 15-17 | 3 | |
| α-helix | 22-34 | 13 | |
| β-strand | 40-44 | 5 | 7 |
| α-helix | 51-63 | 13 | |
| α-helix | 77-83 | 7 | |
| β-strand | 90-94 | 5 | 7 |
| α-helix | 101-109 | 9 | |
| α-helix | 114-115 | 2 | |
| β-strand | 121-126 | 6 | 7 |
| α-helix | 128-130 | 3 | |
| α-helix | 133-144 | 12 | |
| β-strand | 150-156 | 7 | 7 |
| α-helix | 159-161 | 3 | |
| α-helix | 164-168 | 5 | |
| β-strand | 171-174 | 4 | 7 |
| α-helix | 175-179 | 5 | |
| α-helix | 180-193 | 14 | |
| β-strand | 198 | 1 | 8 |
| α-helix | 200-210 | 11 | |
| α-helix | 214-227 | 14 | |
| β-strand | 232 | 1 | 8 |
| α-helix | 234-240 | 7 | |
| α-helix | 243-245 | 3 | |
| α-helix | 247-257 | 11 | |
| α-helix | 261-274 | 14 | |
| α-helix | 278-295 | 18 | |
| α-helix | 299-301 | 3 | |
| α-helix | 304-306 | 3 | |
| α-helix | 310-319 | 10 | |
| α-helix | 322-337 | 16 | |
| α-helix | 339-341 | 3 | |
| α-helix | 346-357 | 12 | |
Chain E: 21 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-7 | 3 | |
| α-helix | 8-20 | 13 | |
| β-strand | 26-31 | 6 | 9 |
| α-helix | 37-49 | 13 | |
| β-strand | 54 | 1 | 10 |
| β-strand | 57 | 1 | 10 |
| α-helix | 63-69 | 7 | |
| β-strand | 76-79 | 4 | 9 |
| β-strand | 88 | 1 | 11 |
| α-helix | 90-99 | 10 | |
| β-strand | 110-114 | 5 | 9 |
| α-helix | 117-119 | 3 | |
| β-strand | 120 | 1 | 11 |
| α-helix | 122-133 | 12 | |
| β-strand | 139-145 | 7 | 9 |
| α-helix | 148-150 | 3 | |
| α-helix | 153-156 | 4 | |
| β-strand | 160-164 | 5 | 9 |
| α-helix | 165-167 | 3 | |
| α-helix | 169-176 | 8 | |
| α-helix | 184-193 | 10 | |
| α-helix | 200-206 | 7 | |
| α-helix | 209-226 | 18 | |
| α-helix | 230-232 | 3 | |
| α-helix | 233-236 | 4 | |
| α-helix | 241-258 | 18 | |
| α-helix | 271-280 | 10 | |
| α-helix | 283-302 | 20 | |
| α-helix | 308-323 | 16 | |
| α-helix | 327-330 | 4 | |
Chain F: 18 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-4 | 3 | 12 |
| α-helix | 6-12 | 7 | |
| β-strand | 20-25 | 6 | 12 |
| α-helix | 28-43 | 16 | |
| β-strand | 49-51 | 3 | 12 |
| β-strand | 54 | 1 | 12 |
| β-strand | 78-83 | 6 | 12 |
| α-helix | 93-100 | 8 | |
| β-strand | 108-114 | 7 | 12 |
| α-helix | 115-118 | 4 | |
| α-helix | 119-122 | 4 | |
| α-helix | 125-127 | 3 | |
| β-strand | 134-139 | 6 | 12 |
| α-helix | 140-142 | 3 | |
| α-helix | 147-157 | 11 | |
| β-strand | 161-162 | 2 | 13 |
| α-helix | 164-174 | 11 | |
| α-helix | 178-191 | 14 | |
| β-strand | 196-197 | 2 | 13 |
| α-helix | 199-203 | 5 | |
| α-helix | 214-223 | 10 | |
| α-helix | 226-238 | 13 | |
| α-helix | 243-263 | 21 | |
| α-helix | 269-276 | 8 | |
| α-helix | 282-292 | 11 | |
| α-helix | 295-313 | 19 | |
| α-helix | 320-330 | 11 | |
Chain G: 26 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | -8--4 | 5 | |
| α-helix | 3-5 | 3 | |
| α-helix | 6-9 | 4 | |
| α-helix | 22-33 | 12 | |
| β-strand | 40-44 | 5 | 14 |
| α-helix | 51-61 | 11 | |
| α-helix | 77-84 | 8 | |
| β-strand | 90-94 | 5 | 14 |
| α-helix | 101-107 | 7 | |
| α-helix | 108-110 | 3 | |
| α-helix | 114-115 | 2 | |
| β-strand | 121-126 | 6 | 14 |
| α-helix | 128-130 | 3 | |
| α-helix | 133-144 | 12 | |
| β-strand | 150-155 | 6 | 14 |
| α-helix | 159-161 | 3 | |
| α-helix | 164-167 | 4 | |
| β-strand | 171-174 | 4 | 14 |
| α-helix | 175-179 | 5 | |
| α-helix | 180-193 | 14 | |
| β-strand | 198 | 1 | 15 |
| α-helix | 200-209 | 10 | |
| α-helix | 214-227 | 14 | |
| β-strand | 232 | 1 | 15 |
| α-helix | 234-243 | 10 | |
| α-helix | 248-257 | 10 | |
| α-helix | 261-273 | 13 | |
| α-helix | 278-294 | 17 | |
| α-helix | 299-301 | 3 | |
| α-helix | 307-318 | 12 | |
| α-helix | 322-338 | 17 | |
| α-helix | 345-358 | 14 | |
| α-helix | 364-367 | 4 | |
Chain H: 26 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 15-17 | 3 | |
| α-helix | 22-33 | 12 | |
| β-strand | 40-44 | 5 | 16 |
| α-helix | 51-63 | 13 | |
| α-helix | 77-83 | 7 | |
| β-strand | 90-94 | 5 | 16 |
| α-helix | 101-109 | 9 | |
| α-helix | 114-115 | 2 | |
| β-strand | 121-126 | 6 | 16 |
| α-helix | 128-130 | 3 | |
| α-helix | 133-138 | 6 | |
| α-helix | 140-144 | 5 | |
| β-strand | 150-156 | 7 | 16 |
| α-helix | 159-161 | 3 | |
| α-helix | 164-167 | 4 | |
| β-strand | 171-174 | 4 | 16 |
| α-helix | 175-179 | 5 | |
| α-helix | 180-193 | 14 | |
| β-strand | 198 | 1 | 17 |
| α-helix | 200-209 | 10 | |
| α-helix | 214-228 | 15 | |
| β-strand | 232 | 1 | 17 |
| α-helix | 234-241 | 8 | |
| α-helix | 243-245 | 3 | |
| α-helix | 247-257 | 11 | |
| α-helix | 261-273 | 13 | |
| α-helix | 278-297 | 20 | |
| α-helix | 299-301 | 3 | |
| α-helix | 310-319 | 10 | |
| α-helix | 322-338 | 17 | |
| α-helix | 345-358 | 14 | |
| α-helix | 364-367 | 4 | |
2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| DNA polymerase III subunit delta | A, F | protein | 343 | Escherichia coli | P28630 (AlphaFold model) |
| DNA polymerase III subunit tau | B, C, D, G, H, I | protein | 395 | Escherichia coli | P06710 (AlphaFold model) |
| DNA polymerase III subunit delta' | E, J | protein | 334 | Escherichia coli | P28631 (AlphaFold model) |
| DNA (5'-d(*tp*tp*tp*tp*tp*tp*ap*tp*ap*gp*gp*cp*cp*ap*g)-3') | K, M | DNA | 15 | | |
| DNA (5'-d(*cp*tp*gp*gp*cp*cp*tp*ap*tp*a)-3') | L, N | DNA | 10 | | |
Sequence of entity 1 (A, F), FASTA
>3GLF_1 DNA polymerase III subunit delta (chains A, F)
MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAVRQVAAAQGFEEHHTFSIDPNTD
WNAIFSLCQAMSLFASRQTLLLLLPENGPNAAINEQLLTLTGLLHDDLLLIVRGNKLSKA
QENAAWFTALANRSVQVTCQTPEQAQLPRWVAARAKQLNLELDDAANQVLCYCYEGNLLA
LAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALLMGKSKRALHILQQLRLEG
SEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQNRRGMMGEALNRLSQTQLRQ
AVQLLTRTELTLKQDYGQSVWAELEGLSLLLCHKPLADVFIDG
Sequence of entity 2 (B, C, D, G, H, I), FASTA
>3GLF_2 DNA polymerase III subunit tau (chains B, C, D, G, H, I)
MGSSHHHHHHSSGLEVLFQGPHMSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIH
HAYLFSGTRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASR
TKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTD
PQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLARAAEGSLRDAL
SLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAMVEANGERVMALINEAAARGIEW
EALLVEMLGLLHRIAMVQLSPAALGNDMAAIELRMRELARTIPPTDIQLYYQTLLIGRKE
LPYAPDRRMGVEMTLLRALAFHPRMPLPEPEVPRQ
Sequence of entity 3 (E, J), FASTA
>3GLF_3 DNA polymerase III subunit delta' (chains E, J)
MRWYPWLRPDFEKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQPQGHKSCG
HCRGCQLMQAGTHPDYYTLAPEKGKNTLGVDAVREVTEKLNEHARLGGAKVVWVTDAALL
TDAAANALLKTLEEPPAETWFFLATREPERLLATLRSRCRLHYLAPPPEQYAVTWLSREV
TMSQDALLAALRLSAGSPGAALALFQGDNWQARETLCQALAYSVPSGDWYSLLAALNHEQ
APARLHWLATLLMDALKRHHGAAQVTNVDVPGLVAELANHLSPSRLQAILGDVCHIREQL
MSVTGINRELLITDLLLRIEHYLQPGVVLPVPHL
Sequence of entity 4 (K, M), FASTA
>3GLF_4 DNA (5'-D(*TP*TP*TP*TP*TP*TP*AP*TP*AP*GP*GP*CP*CP*AP*G)-3') (chains K, M)
TTTTTTATAGGCCAG
Sequence of entity 5 (L, N), FASTA
>3GLF_5 DNA (5'-D(*CP*TP*GP*GP*CP*CP*TP*AP*TP*A)-3') (chains L, N)
CTGGCCTATA
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| BEF | Beryllium trifluoride ion | Be F3 | 6 |
| ZN | Zinc ion | Zn | 8 |
| MG | Magnesium ion | Mg | 6 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 6 |
Primary citation
The mechanism of ATP-dependent primer-template recognition by a clamp loader complex. Simonetta, K.R., Kazmirski, S.L., Goedken, E.R. et al. Cell (2009) 137:659-671. DOI 10.1016/j.cell.2009.03.044 · PubMed
Other PDB entries of the same protein (UniProt P28630 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1JQL 2.5 Å, Mechanism of Processivity Clamp Opening by the Delta Subunit Wrench of the Clamp Loader…
- 9OYJ 2.53 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 9OYH 2.54 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 9OYI 2.54 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 8GJ2 2.6 Å, E. coli clamp loader with closed clamp on primed template DNA
- 9OYK 2.6 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 9OYM 2.6 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 1JR3 2.7 Å, Crystal Structure of the Processivity Clamp Loader Gamma Complex of E. coli DNA…
- 8GIZ 2.7 Å, E. coli clamp loader with open clamp
- 9OYN 2.7 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 9OYC 2.71 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 1-nt gapped…
- 9OYE 2.72 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 1-nt gapped…
Browse structure collections
About this viewer
MolViewer shows 3GLF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.