3GLI: E. coli clamp loader
Crystal Structure of the E. coli clamp loader bound to Primer-Template DNA and Psi Peptide. Determined by X-ray diffraction at 3.5 Å resolution. Released 26 May 2009.
- Method
- X-ray diffraction
- Resolution
- 3.5 Å
- Organisms
- Escherichia coli, Escherichia coLI, ESCHERICHIA COLI
- Chains
- 16
- Atoms
- 29,139
- Mol. weight
- 440.4 kDa
- Ligands
- ADP, BEF, ZN, MG
- Released
- 26 May 2009
Explore 3GLI in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3GLI contains 231 α-helices and 83 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 19 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-4 | 3 | 1 |
| α-helix | 6-15 | 10 | |
| β-strand | 20-25 | 6 | 1 |
| α-helix | 28-44 | 17 | |
| β-strand | 50-54 | 5 | 1 |
| β-strand | 78-83 | 6 | 1 |
| α-helix | 84-85 | 2 | |
| α-helix | 94-101 | 8 | |
| β-strand | 108-114 | 7 | 1 |
| α-helix | 116-118 | 3 | |
| α-helix | 119-122 | 4 | |
| α-helix | 125-130 | 6 | |
| β-strand | 135-139 | 5 | 1 |
| α-helix | 140-143 | 4 | |
| α-helix | 147-157 | 11 | |
| β-strand | 161-162 | 2 | 2 |
| α-helix | 164-174 | 11 | |
| α-helix | 178-191 | 14 | |
| β-strand | 196-197 | 2 | 2 |
| α-helix | 199-204 | 6 | |
| α-helix | 215-223 | 9 | |
| α-helix | 226-238 | 13 | |
| α-helix | 243-266 | 24 | |
| α-helix | 269-275 | 7 | |
| α-helix | 280-292 | 13 | |
| α-helix | 295-313 | 19 | |
| α-helix | 321-330 | 10 | |
Chain B: 23 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 15-17 | 3 | |
| α-helix | 22-33 | 12 | |
| β-strand | 40-44 | 5 | 3 |
| α-helix | 51-63 | 13 | |
| α-helix | 77-84 | 8 | |
| β-strand | 90-91 | 2 | 3 |
| β-strand | 94 | 1 | 3 |
| α-helix | 101-107 | 7 | |
| α-helix | 114-115 | 2 | |
| β-strand | 121-126 | 6 | 3 |
| α-helix | 128-130 | 3 | |
| α-helix | 133-143 | 11 | |
| β-strand | 150-155 | 6 | 3 |
| α-helix | 159-161 | 3 | |
| α-helix | 164-167 | 4 | |
| β-strand | 171-174 | 4 | 3 |
| α-helix | 175-179 | 5 | |
| α-helix | 180-194 | 15 | |
| β-strand | 197-198 | 2 | 4 |
| α-helix | 200-209 | 10 | |
| α-helix | 214-227 | 14 | |
| β-strand | 231-232 | 2 | 4 |
| α-helix | 234-243 | 10 | |
| α-helix | 248-257 | 10 | |
| α-helix | 261-274 | 14 | |
| α-helix | 278-295 | 18 | |
| α-helix | 299-301 | 3 | |
| α-helix | 310-318 | 9 | |
| α-helix | 322-338 | 17 | |
| α-helix | 345-358 | 14 | |
| β-strand | 359-362 | 4 | 5 |
Chain C: 23 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 15-17 | 3 | |
| α-helix | 22-33 | 12 | |
| β-strand | 40-44 | 5 | 6 |
| α-helix | 51-62 | 12 | |
| α-helix | 77-83 | 7 | |
| β-strand | 90-94 | 5 | 6 |
| α-helix | 101-109 | 9 | |
| α-helix | 114-115 | 2 | |
| β-strand | 121-126 | 6 | 6 |
| α-helix | 128-130 | 3 | |
| α-helix | 133-144 | 12 | |
| β-strand | 150-156 | 7 | 6 |
| α-helix | 159-161 | 3 | |
| α-helix | 164-167 | 4 | |
| β-strand | 171-174 | 4 | 6 |
| α-helix | 175-179 | 5 | |
| α-helix | 180-193 | 14 | |
| β-strand | 198 | 1 | 7 |
| α-helix | 200-209 | 10 | |
| α-helix | 214-228 | 15 | |
| β-strand | 232 | 1 | 7 |
| α-helix | 234-241 | 8 | |
| α-helix | 247-257 | 11 | |
| α-helix | 261-273 | 13 | |
| α-helix | 278-297 | 20 | |
| α-helix | 307-319 | 13 | |
| α-helix | 322-338 | 17 | |
| α-helix | 345-359 | 15 | |
| α-helix | 365-367 | 3 | |
Chain D: 26 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 15-17 | 3 | |
| α-helix | 22-34 | 13 | |
| β-strand | 40-44 | 5 | 8 |
| α-helix | 51-63 | 13 | |
| α-helix | 77-83 | 7 | |
| β-strand | 92-94 | 3 | 8 |
| α-helix | 101-109 | 9 | |
| α-helix | 114-115 | 2 | |
| β-strand | 121-126 | 6 | 8 |
| α-helix | 128-130 | 3 | |
| α-helix | 133-144 | 12 | |
| β-strand | 150-156 | 7 | 8 |
| α-helix | 159-161 | 3 | |
| α-helix | 164-167 | 4 | |
| β-strand | 171-174 | 4 | 8 |
| α-helix | 175-179 | 5 | |
| α-helix | 180-193 | 14 | |
| β-strand | 198 | 1 | 9 |
| α-helix | 200-210 | 11 | |
| α-helix | 214-228 | 15 | |
| β-strand | 232 | 1 | 9 |
| α-helix | 234-240 | 7 | |
| α-helix | 243-245 | 3 | |
| α-helix | 247-257 | 11 | |
| α-helix | 261-274 | 14 | |
| α-helix | 278-297 | 20 | |
| α-helix | 299-301 | 3 | |
| α-helix | 304-308 | 5 | |
| α-helix | 310-319 | 10 | |
| α-helix | 322-337 | 16 | |
| α-helix | 339-341 | 3 | |
| α-helix | 345-357 | 13 | |
Chains E and J: 21 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-7 | 3 | |
| α-helix | 8-20 | 13 | |
| β-strand | 26-30 | 5 | 10 |
| α-helix | 37-48 | 12 | |
| β-strand | 54 | 1 | 11 |
| β-strand | 57 | 1 | 11 |
| α-helix | 63-69 | 7 | |
| β-strand | 76-79 | 4 | 10 |
| β-strand | 88 | 1 | 12 |
| α-helix | 90-99 | 10 | |
| β-strand | 110-114 | 5 | 10 |
| α-helix | 117-119 | 3 | |
| β-strand | 120 | 1 | 12 |
| α-helix | 122-133 | 12 | |
| β-strand | 139-145 | 7 | 10 |
| α-helix | 148-150 | 3 | |
| α-helix | 153-156 | 4 | |
| β-strand | 160-163 | 4 | 10 |
| α-helix | 165-168 | 4 | |
| α-helix | 169-179 | 11 | |
| α-helix | 184-193 | 10 | |
| α-helix | 200-206 | 7 | |
| α-helix | 209-226 | 18 | |
| α-helix | 230-232 | 3 | |
| α-helix | 233-236 | 4 | |
| α-helix | 241-258 | 18 | |
| α-helix | 271-280 | 10 | |
| α-helix | 283-302 | 20 | |
| α-helix | 308-323 | 16 | |
| α-helix | 327-330 | 4 | |
Chain F: 18 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-4 | 3 | 13 |
| α-helix | 6-15 | 10 | |
| β-strand | 20-25 | 6 | 13 |
| α-helix | 28-44 | 17 | |
| β-strand | 50-54 | 5 | 13 |
| β-strand | 78-83 | 6 | 13 |
| α-helix | 94-101 | 8 | |
| β-strand | 108-114 | 7 | 13 |
| α-helix | 116-118 | 3 | |
| α-helix | 119-122 | 4 | |
| α-helix | 125-130 | 6 | |
| β-strand | 135-139 | 5 | 13 |
| α-helix | 140-143 | 4 | |
| α-helix | 147-157 | 11 | |
| β-strand | 161-162 | 2 | 14 |
| α-helix | 164-174 | 11 | |
| α-helix | 178-191 | 14 | |
| β-strand | 196-197 | 2 | 14 |
| α-helix | 199-204 | 6 | |
| α-helix | 215-223 | 9 | |
| α-helix | 226-238 | 13 | |
| α-helix | 243-266 | 24 | |
| α-helix | 269-275 | 7 | |
| α-helix | 280-292 | 13 | |
| α-helix | 295-313 | 19 | |
| α-helix | 320-330 | 11 | |
Chain G: 25 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | -7--5 | 3 | |
| β-strand | 3 | 1 | 15 |
| α-helix | 4-5 | 2 | |
| α-helix | 6-9 | 4 | |
| α-helix | 15-17 | 3 | |
| α-helix | 22-33 | 12 | |
| β-strand | 40-44 | 5 | 16 |
| α-helix | 51-63 | 13 | |
| α-helix | 77-84 | 8 | |
| β-strand | 90-94 | 5 | 16 |
| α-helix | 101-107 | 7 | |
| α-helix | 114-115 | 2 | |
| β-strand | 121-126 | 6 | 16 |
| α-helix | 128-130 | 3 | |
| α-helix | 133-143 | 11 | |
| β-strand | 150-155 | 6 | 16 |
| α-helix | 159-161 | 3 | |
| α-helix | 164-167 | 4 | |
| β-strand | 171-174 | 4 | 16 |
| α-helix | 175-179 | 5 | |
| α-helix | 180-194 | 15 | |
| β-strand | 197-198 | 2 | 17 |
| α-helix | 200-209 | 10 | |
| α-helix | 214-227 | 14 | |
| β-strand | 231-232 | 2 | 17 |
| α-helix | 234-243 | 10 | |
| α-helix | 248-257 | 10 | |
| α-helix | 261-274 | 14 | |
| α-helix | 278-295 | 18 | |
| α-helix | 299-301 | 3 | |
| α-helix | 310-318 | 9 | |
| α-helix | 322-338 | 17 | |
| α-helix | 345-358 | 14 | |
| β-strand | 359-362 | 4 | 18 |
Chain H: 23 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 15-17 | 3 | |
| α-helix | 22-33 | 12 | |
| β-strand | 36 | 1 | 15 |
| β-strand | 40-44 | 5 | 19 |
| α-helix | 51-62 | 12 | |
| α-helix | 77-83 | 7 | |
| β-strand | 90-94 | 5 | 19 |
| α-helix | 101-109 | 9 | |
| α-helix | 114-115 | 2 | |
| β-strand | 121-126 | 6 | 19 |
| α-helix | 128-130 | 3 | |
| α-helix | 133-144 | 12 | |
| β-strand | 150-156 | 7 | 19 |
| α-helix | 159-161 | 3 | |
| α-helix | 164-167 | 4 | |
| β-strand | 171-174 | 4 | 19 |
| α-helix | 175-179 | 5 | |
| α-helix | 180-193 | 14 | |
| β-strand | 198 | 1 | 20 |
| α-helix | 200-209 | 10 | |
| α-helix | 214-227 | 14 | |
| β-strand | 232 | 1 | 20 |
| α-helix | 234-241 | 8 | |
| α-helix | 247-257 | 11 | |
| α-helix | 261-273 | 13 | |
| α-helix | 278-297 | 20 | |
| α-helix | 307-319 | 13 | |
| α-helix | 322-336 | 15 | |
| α-helix | 345-359 | 15 | |
| α-helix | 365-367 | 3 | |
3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| DNA polymerase III subunit delta | A, F | protein | 343 | Escherichia coli | P28630 (AlphaFold model) |
| DNA polymerase III subunit tau | B, C, D, G, H, I | protein | 395 | Escherichia coli | P06710 (AlphaFold model) |
| DNA polymerase III subunit delta' | E, J | protein | 334 | Escherichia coLI | P28631 (AlphaFold model) |
| DNA (5'-d(*tp*tp*tp*tp*tp*tp*ap*tp*ap*gp*gp*cp*cp*ap*g)-3') | K, M | DNA | 15 | | |
| DNA (5'-d(*cp*tp*gp*gp*cp*cp*tp*ap*tp*a)-3') | L, N | DNA | 10 | | |
| DNA polymerase III subunit psi | O, P | protein | 27 | ESCHERICHIA COLI | P28632 (AlphaFold model) |
Sequence of entity 1 (A, F), FASTA
>3GLI_1 DNA polymerase III subunit delta (chains A, F)
MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAVRQVAAAQGFEEHHTFSIDPNTD
WNAIFSLCQAMSLFASRQTLLLLLPENGPNAAINEQLLTLTGLLHDDLLLIVRGNKLSKA
QENAAWFTALANRSVQVTCQTPEQAQLPRWVAARAKQLNLELDDAANQVLCYCYEGNLLA
LAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALLMGKSKRALHILQQLRLEG
SEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQNRRGMMGEALNRLSQTQLRQ
AVQLLTRTELTLKQDYGQSVWAELEGLSLLLCHKPLADVFIDG
Sequence of entity 2 (B, C, D, G, H, I), FASTA
>3GLI_2 DNA polymerase III subunit tau (chains B, C, D, G, H, I)
MGSSHHHHHHSSGLEVLFQGPHMSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIH
HAYLFSGTRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASR
TKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTD
PQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLARAAEGSLRDAL
SLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAMVEANGERVMALINEAAARGIEW
EALLVEMLGLLHRIAMVQLSPAALGNDMAAIELRMRELARTIPPTDIQLYYQTLLIGRKE
LPYAPDRRMGVEMTLLRALAFHPRMPLPEPEVPRQ
Sequence of entity 3 (E, J), FASTA
>3GLI_3 DNA polymerase III subunit delta' (chains E, J)
MRWYPWLRPDFEKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQPQGHKSCG
HCRGCQLMQAGTHPDYYTLAPEKGKNTLGVDAVREVTEKLNEHARLGGAKVVWVTDAALL
TDAAANALLKTLEEPPAETWFFLATREPERLLATLRSRCRLHYLAPPPEQYAVTWLSREV
TMSQDALLAALRLSAGSPGAALALFQGDNWQARETLCQALAYSVPSGDWYSLLAALNHEQ
APARLHWLATLLMDALKRHHGAAQVTNVDVPGLVAELANHLSPSRLQAILGDVCHIREQL
MSVTGINRELLITDLLLRIEHYLQPGVVLPVPHL
Sequence of entity 4 (K, M), FASTA
>3GLI_4 DNA (5'-D(*TP*TP*TP*TP*TP*TP*AP*TP*AP*GP*GP*CP*CP*AP*G)-3') (chains K, M)
TTTTTTATAGGCCAG
Sequence of entity 5 (L, N), FASTA
>3GLI_5 DNA (5'-D(*CP*TP*GP*GP*CP*CP*TP*AP*TP*A)-3') (chains L, N)
CTGGCCTATA
Sequence of entity 6 (O, P), FASTA
>3GLI_6 DNA polymerase III subunit psi (chains O, P)
TSRRDWQLQQLGITQWSLRRPGALQGE
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 6 |
| BEF | Beryllium trifluoride ion | Be F3 | 6 |
| ZN | Zinc ion | Zn | 8 |
| MG | Magnesium ion | Mg | 6 |
Primary citation
The mechanism of ATP-dependent primer-template recognition by a clamp loader complex. Simonetta, K.R., Kazmirski, S.L., Goedken, E.R. et al. Cell (2009) 137:659-671. DOI 10.1016/j.cell.2009.03.044 · PubMed
Other PDB entries of the same protein (UniProt P28630 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1JQL 2.5 Å, Mechanism of Processivity Clamp Opening by the Delta Subunit Wrench of the Clamp Loader…
- 9OYJ 2.53 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 9OYH 2.54 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 9OYI 2.54 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 8GJ2 2.6 Å, E. coli clamp loader with closed clamp on primed template DNA
- 9OYK 2.6 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 9OYM 2.6 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 1JR3 2.7 Å, Crystal Structure of the Processivity Clamp Loader Gamma Complex of E. coli DNA…
- 8GIZ 2.7 Å, E. coli clamp loader with open clamp
- 9OYN 2.7 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
- 9OYC 2.71 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 1-nt gapped…
- 9OYE 2.72 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 1-nt gapped…
Browse structure collections
About this viewer
MolViewer shows 3GLI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.