3GM2: Focal Adhesion Targeting (FAT) Domain of Pyk2

Crystal Structure of the Focal Adhesion Targeting (FAT) Domain of Pyk2. Determined by X-ray diffraction at 2.71 Å resolution. Released 5 May 2009.

Method: X-ray diffraction
Resolution: 2.71 Å
Organism: Homo sapiens
Chains: 1
Atoms: 909
Mol. weight: 16.69 kDa
Released: 5 May 2009

Explore 3GM2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GM2 contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	879-900	22
α-helix	903-926	24
α-helix	936-962	27
α-helix	969-996	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein tyrosine kinase 2 beta	A	protein	153	Homo sapiens	Q14289 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3GM2_1 Protein tyrosine kinase 2 beta (chains A)
GSHMRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELAQLPPEGYVVVVKNVGLT
LRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQM
LTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE

Primary citation

Crystal structures of free and ligand-bound focal adhesion targeting domain of Pyk2. Lulo, J., Yuzawa, S., Schlessinger, J. Biochem Biophys Res Commun (2009) 383:347-352. DOI 10.1016/j.bbrc.2009.04.011 · PubMed

Other PDB entries of the same protein (UniProt Q14289 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CC6 1.6 Å, Crystal structure of kinase domain of protein tyrosine kinase 2 beta (PTK2B)
3FZS 1.75 Å, Crystal Structure of PYK2 complexed with BIRB796
4XEK 1.79 Å, Pyk2-FAT domain in complex with leupaxin LD4 motif
8XOX 1.9 Å, The Crystal Structure of FAK2 from Biortus.
3FZT 1.95 Å, Crystal structure of PYK2 complexed with PF-4618433
5TO8 1.98 Å, Selectivity switch between FAK and Pyk2: Macrocyclization of FAK inhibitors improves…
4H1M 1.99 Å, Crystal structure of PYK2 with the indole 10c
3H3C 2.0 Å, Crystal structure of PYK2 in complex with Sulfoximine-substituted…
4H1J 2.0 Å, Crystal structure of PYK2 with the pyrazole 13a
8YGX 2.0 Å, Structure of the PYK2 from Biortus.
4XEV 2.01 Å, Fusion of Pyk2-FAT domain with Leupaxin LD1 motif, complexed with Leupaxin LD4 peptide
3FZP 2.1 Å, Crystal structure of PYK2 complexed with ATPgS

Browse structure collections

About this viewer

MolViewer shows 3GM2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.