3GTM: DNA-directed RNA polymerase II subunit RPB1

Co-complex of Backtracked RNA polymerase II with TFIIS. Determined by X-ray diffraction at 3.8 Å resolution. Released 9 Jun 2009.

Method: X-ray diffraction
Resolution: 3.8 Å
Organisms: Saccharomyces cerevisiae (strain ATCC 204508 / S288c), synthetic construct
Chains: 14
Atoms: 30,560
Mol. weight: 507.01 kDa
Ligands: ZN, MG
Released: 9 Jun 2009

Explore 3GTM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GTM contains 155 α-helices and 212 β-strands across 11 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 72 helices, 73 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	1
β-strand	16	1	2
β-strand	17-18	2	3
β-strand	19-21	3	4
α-helix	24-30	7
β-strand	33	1	5
β-strand	82-91	10	5
α-helix	93-95	3
α-helix	96-104	9
β-strand	106-107	2	6
β-strand	112-113	2	6
α-helix	120-127	8
α-helix	131-142	12
β-strand	147	1	7
β-strand	151-153	3	8
β-strand	161-163	3	8
β-strand	170	1	7
β-strand	175-177	3	9
β-strand	180-185	6	9
β-strand	198-202	5	9
α-helix	203	1
α-helix	204-211	8
α-helix	217-220	4
α-helix	231-234	4
β-strand	235-241	7	5
α-helix	244-246	3
α-helix	261-280	20
α-helix	289-302	14
β-strand	316	1	10
β-strand	320	1	10
α-helix	325-328	4
α-helix	337-341	5
β-strand	344	1	11
β-strand	348-352	5	12
β-strand	353-355	3	13
β-strand	363-364	2	12
β-strand	365	1	13
β-strand	367	1	14
α-helix	368-373	6
β-strand	375-379	5	15
α-helix	380	1
α-helix	385-394	10
β-strand	402-407	6	15
β-strand	411-413	3	15
β-strand	431-435	5	15
α-helix	436	1
β-strand	441-445	5	12
β-strand	455-460	6	12
β-strand	463	1	14
β-strand	468-470	3	13
α-helix	472-474	3
α-helix	475-478	4
β-strand	486-490	5	12
α-helix	495-502	8
β-strand	506	1	12
α-helix	508-510	3
β-strand	512-513	2	16
β-strand	518-519	2	16
α-helix	526-535	10
β-strand	540-542	3	17
α-helix	543-552	10
α-helix	560-563	4
β-strand	565	1	18
β-strand	571-573	3	17
α-helix	574-578	5
β-strand	587-589	3	19
β-strand	606-608	3	19
β-strand	612-614	3	19
α-helix	619-622	4
α-helix	629-637	9
α-helix	639-660	22
β-strand	663	1	20
α-helix	666-669	4
α-helix	673-682	10
α-helix	684-695	12
α-helix	710-736	27
α-helix	742-749	8
α-helix	755-758	4
α-helix	759-763	5
β-strand	766-767	2	21
β-strand	769-771	3	22
β-strand	773-774	2	22
α-helix	775-776	2
β-strand	799-800	2	21
α-helix	810-825	16
α-helix	829-845	17
β-strand	849-850	2	23
β-strand	856-857	2	23
β-strand	863-865	3	23
α-helix	868-870	3
β-strand	873	1	24
β-strand	879-882	4	25
α-helix	890-897	8
β-strand	913	1	26
α-helix	923-946	24
β-strand	953-956	4	25
α-helix	960-970	11
α-helix	978	1
β-strand	979	1	26
α-helix	983-991	9
α-helix	1005-1025	21
α-helix	1028-1031	4
α-helix	1039-1054	16
β-strand	1057	1	24
α-helix	1058-1059	2
α-helix	1064-1073	10
α-helix	1079-1080	2
α-helix	1097-1104	8
β-strand	1116-1117	2	27
β-strand	1118-1119	2	28
β-strand	1120	1	29
α-helix	1121	1
α-helix	1123-1125	3
α-helix	1128-1135	8
β-strand	1141-1142	2	30
α-helix	1143-1146	4
β-strand	1147-1154	8	31
α-helix	1167-1170	4
α-helix	1172-1175	4
β-strand	1191-1197	7	31
α-helix	1198	1
α-helix	1201-1203	3
α-helix	1209-1216	8
β-strand	1224-1228	5	31
β-strand	1236-1242	7	31
α-helix	1259-1269	11
β-strand	1272-1274	3	30
β-strand	1280-1287	8	28
β-strand	1290-1292	3	32
β-strand	1298-1300	3	32
β-strand	1303-1309	7	28
α-helix	1313-1316	4
β-strand	1322	1	29
β-strand	1328-1329	2	27
α-helix	1334-1337	4
α-helix	1341-1358	18
α-helix	1365-1374	10
α-helix	1389-1391	3
α-helix	1396-1399	4
α-helix	1406-1414	9
β-strand	1418-1419	2	3
α-helix	1424-1429	6
α-helix	1437-1439	3
β-strand	1441-1445	5	33
α-helix	1447-1449	3

Chain B: 44 helices, 77 β-strands

Element	Residues	Length	Sheet
α-helix	29-41	13
α-helix	45-52	8
α-helix	53-58	6
α-helix	59-62	4
β-strand	92-97	6	34
α-helix	98-100	3
β-strand	101-103	3	35
β-strand	109-111	3	35
α-helix	114-119	6
β-strand	125-132	8	34
β-strand	165-171	7	34
β-strand	173	1	36
α-helix	180-183	4
α-helix	186-191	6
β-strand	203-205	3	36
β-strand	208-211	4	36
α-helix	212-213	2
β-strand	214-218	5	37
β-strand	224-227	4	38
β-strand	234-239	6	38
β-strand	241-242	2	39
β-strand	252-253	2	39
β-strand	255-259	5	38
β-strand	270-272	3	38
β-strand	279-281	3	38
α-helix	282-289	8
α-helix	298-300	3
α-helix	308-319	12
α-helix	327-333	7
α-helix	349-358	10
α-helix	371-390	20
α-helix	401-403	3
β-strand	404-407	4	37
α-helix	409-425	17
α-helix	428-433	6
α-helix	451-463	13
β-strand	481-482	2	36
α-helix	488-495	8
β-strand	497-499	3	37
α-helix	510-512	3
α-helix	516-518	3
β-strand	522	1	40
β-strand	537-538	2	37
β-strand	539	1	40
β-strand	544-545	2	41
α-helix	552-560	9
β-strand	563-565	3	42
α-helix	566-568	3
α-helix	577	1
β-strand	578-582	5	42
β-strand	585-590	6	42
α-helix	593-605	13
β-strand	614-618	5	42
α-helix	619-621	3
β-strand	623-627	5	42
β-strand	633-639	7	41
α-helix	655-664	10
α-helix	681-686	6
β-strand	690-694	5	41
α-helix	695-698	4
β-strand	703-704	2	41
β-strand	740-741	2	41
α-helix	745-748	4
α-helix	752-755	4
α-helix	759-761	3
β-strand	762	1	43
α-helix	764-770	7
β-strand	777	1	44
α-helix	783-786	4
β-strand	794-796	3	45
β-strand	804-805	2	46
α-helix	807-810	4
β-strand	821-824	4	47
β-strand	825	1	48
β-strand	827	1	49
β-strand	828	1	20
β-strand	838-841	4	48
α-helix	843-848	6
β-strand	853-862	10	45
β-strand	873-874	2	50
α-helix	890-892	3
β-strand	898	1	51
β-strand	904-905	2	45
β-strand	910-912	3	51
β-strand	914-916	3	50
β-strand	935-936	2	50
β-strand	939-940	2	51
β-strand	947-956	10	45
β-strand	962-972	11	45
β-strand	979	1	48
β-strand	981	1	52
β-strand	989-992	4	48
β-strand	1001-1002	2	53
β-strand	1010-1011	2	48
α-helix	1014-1016	3
β-strand	1022	1	43
α-helix	1023-1038	16
β-strand	1042-1043	2	46
α-helix	1053-1061	9
β-strand	1069-1070	2	49
β-strand	1072-1073	2	53
β-strand	1080	1	53
β-strand	1085-1086	2	49
β-strand	1089-1092	4	47
β-strand	1093	1	52
β-strand	1095	1	44
β-strand	1104-1106	3	12
β-strand	1111	1	54
β-strand	1118	1	54
β-strand	1120	1	55
β-strand	1127	1	55
β-strand	1129	1	11
α-helix	1132-1141	10
α-helix	1144-1149	6
β-strand	1160-1163	4	1
β-strand	1174	1	56
β-strand	1179	1	56
β-strand	1191-1194	4	1
α-helix	1198-1208	11
β-strand	1212-1214	3	4
β-strand	1217	1	2

Chain C: 10 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	57
β-strand	12-13	2	57
β-strand	17-23	7	57
α-helix	27-39	13
β-strand	48-54	7	58
α-helix	60-69	10
β-strand	72	1	59
α-helix	77-79	3
β-strand	97-103	7	58
β-strand	111-114	4	60
β-strand	119-120	2	58
α-helix	131	1
β-strand	132	1	59
α-helix	133	1
β-strand	143-147	5	60
β-strand	153-159	7	58
β-strand	177-180	4	57
α-helix	197-200	4
α-helix	202-203	2
α-helix	205-207	3
β-strand	228-233	6	57
α-helix	240-244	5
α-helix	246-263	18

Chain E: 12 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	7-26	20
β-strand	28	1	61
α-helix	32-36	5
α-helix	39-46	8
β-strand	47	1	62
β-strand	53	1	62
α-helix	55-57	3
β-strand	61-62	2	63
β-strand	64	1	61
β-strand	78-82	5	63
β-strand	87-88	2	64
α-helix	89	1
α-helix	90-103	14
β-strand	107-112	6	63
β-strand	115-116	2	64
α-helix	120-122	3
β-strand	131-136	6	63
α-helix	144-146	3
β-strand	152	1	65
β-strand	155	1	65
α-helix	156-157	2
α-helix	158-168	11
β-strand	177-178	2	65
α-helix	183-187	5
β-strand	195-201	7	65
β-strand	207-214	8	65

Chain F: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	84	1	66
α-helix	87-102	16
α-helix	117-126	10
β-strand	132-137	6	33
α-helix	138	1
β-strand	143-147	5	33
β-strand	152	1	66

Chain H: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7-16	10	18
β-strand	23-30	8	18
β-strand	37-43	7	18
β-strand	54-58	5	18
α-helix	84-86	3
β-strand	95-106	12	18
β-strand	112-118	7	18
β-strand	121-126	6	18
β-strand	140-145	6	18

Chain I: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	67
β-strand	13	1	67
β-strand	14-19	6	68
β-strand	24-29	6	68
β-strand	35-37	3	68
β-strand	42-47	6	31
α-helix	61-64	4
α-helix	73-75	3
β-strand	83-87	5	69
β-strand	99-103	5	69
β-strand	109-111	3	69

Chain J: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	18-26	9
α-helix	32-37	6
α-helix	44-51	8
α-helix	57-60	4

3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase II subunit RPB1	A	protein	1733	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P04050 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB2	B	protein	1224	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P08518 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB3	C	protein	318	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P16370 (AlphaFold model)
DNA-directed RNA polymerases I, II, and III subunit RPABC1	E	protein	215	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P20434 (AlphaFold model)
DNA-directed RNA polymerases I, II, and III subunit RPABC2	F	protein	155	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P20435
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	146	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P20436
DNA-directed RNA polymerase II subunit RPB9	I	protein	122	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P27999
DNA-directed RNA polymerases I, II, and III subunit RPABC5	J	protein	70	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P22139
DNA-directed RNA polymerase II subunit RPB11	K	protein	120	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P38902
DNA-directed RNA polymerases I, II, and III subunit RPABC4	L	protein	70	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P40422
Transcription elongation factor S-II	S	protein	173	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P07273
RNA (5'-r(apupcpgpapgpapgpgpapupgp*c)-3')	M	RNA	13	synthetic construct

2 more molecules are not listed.

Sequence of entity 1 (A), FASTA

>3GTM_1 DNA-directed RNA polymerase II subunit RPB1 (chains A)
MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGS
IDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNE
LMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLK
LVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHV
ATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLE
LDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKR
AGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTF
IELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSP
KDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHN
GFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFV
DRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRR
LVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVD
LLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCC
LLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMT
LNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEH
TTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHML
KKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVP
GIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGG
LTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGS
NDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTS
PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYS
PTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR

Sequence of entity 2 (B), FASTA

>3GTM_2 DNA-directed RNA polymerase II subunit RPB2 (chains B)
MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQ
DIICEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLR
NLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCY
LSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEH
ICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEF
LPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTL
FKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLS
LMSCISVGTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETL
RTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHIAK
LMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGV
FLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMI
MNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIA
PGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSR
MTVAHLIECLLSKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKK
LMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIA
HGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF

Sequence of entity 3 (C), FASTA

>3GTM_3 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI
VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY
SNASQMGNTGSGGYDNAW

Sequence of entity 4 (E), FASTA

>3GTM_4 DNA-directed RNA polymerases I, II, and III subunit RPABC1 (chains E)
MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSF
QANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSA
MKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQR
ADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM

Sequence of entity 5 (F), FASTA

>3GTM_5 DNA-directed RNA polymerases I, II, and III subunit RPABC2 (chains F)
MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQ
HEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRI
AMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL

Sequence of entity 6 (H), FASTA

>3GTM_6 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIA
SSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGG
LLMRLEGNYRNLNNLKQENAYLLIRR

Sequence of entity 7 (I), FASTA

>3GTM_7 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQ
DIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
FS

Sequence of entity 8 (J), FASTA

>3GTM_8 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKF
LRYNPLEKRD

Sequence of entity 9 (K), FASTA

>3GTM_9 DNA-directed RNA polymerase II subunit RPB11 (chains K)
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA
YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF

Sequence of entity 10 (L), FASTA

>3GTM_10 DNA-directed RNA polymerases I, II, and III subunit RPABC4 (chains L)
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKAR
TKRLVQFEAR

Sequence of entity 11 (S), FASTA

>3GTM_11 Transcription elongation factor S-II (chains S)
MRGSHHHHHHKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYK
ARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNA
QGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADHPLTTFCTCEACGNRWKFS

Sequence of entity 12 (M), FASTA

>3GTM_12 RNA (5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*AP*UP*GP*C)-3') (chains M)
AUCGAGAGGAUGC

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	9
MG	Magnesium ion	Mg	1

Primary citation

Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution. Wang, D., Bushnell, D.A., Huang, X. et al. Science (2009) 324:1203-1206. DOI 10.1126/science.1168729 · PubMed

Other PDB entries of the same protein (UniProt P04050 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VKO 1.8 Å, SPT6 tSH2-RPB1 1468-1500 pT1471, pS1493
9SV6 1.96 Å, CryoEM structure of transcribing RNA polymerase II elongation complex with ATP and Elf1
5VKL 2.2 Å, SPT6 tSH2-RPB1 1476-1500 pS1493
9W8V 2.23 Å, Structure of post-translocation state of yeast Pol II complexed with a cisplatin-induced…
9QEB 2.26 Å, CryoEM structure of transcribing RNA polymerase II elongation complex
1TWF 2.3 Å, RNA polymerase II complexed with UTP at 2.3 A resolution
9RYB 2.33 Å, CryoEM structure of transcribing RNA polymerase II elongation complex in post-catalysis…
9KD8 2.46 Å, The structure of RNA polymerase II elongation complex paused at N-2 state by actinomycin…
6NPW 2.49 Å, SSu72/Sympk in complex with Ser2/Ser5 phosphorylated peptide
9K7F 2.5 Å, RNA polymerase II elongation complex apo structure.
30ES 2.54 Å, Cryo-EM structure of the yeast RNA polymerase II elongation complex with 19-mer RNA in…
30EP 2.55 Å, Cryo-EM structure of the yeast RNA polymerase II elongation complex with 19-mer RNA in…

Browse structure collections

About this viewer

MolViewer shows 3GTM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.