3H71: Sialidase A

Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA). Determined by X-ray diffraction at 1.7 Å resolution. Released 12 May 2009.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Streptococcus pneumoniae
Chains: 2
Atoms: 9,263
Mol. weight: 108.27 kDa
Released: 12 May 2009

Explore 3H71 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3H71 contains 26 α-helices and 80 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	323	1	1
α-helix	324-326	3
β-strand	327-330	4	1
β-strand	334	1	2
β-strand	345-353	9	3
β-strand	359-366	8	3
β-strand	376-383	8	3
β-strand	394-397	4	3
α-helix	399-401	3
α-helix	408-410	3
β-strand	414-422	9	4
β-strand	429-436	8	4
α-helix	441-444	4
β-strand	453-456	4	5
β-strand	459-464	6	5
β-strand	465-466	2	6
α-helix	472	1
β-strand	473-475	3	5
α-helix	477-479	3
β-strand	480-482	3	5
β-strand	488-493	6	5
α-helix	500-502	3
β-strand	507-510	4	5
β-strand	513-517	5	5
β-strand	528-529	2	6
β-strand	535-541	7	4
α-helix	549-551	3
β-strand	552-553	2	4
α-helix	555-558	4
β-strand	566-568	3	7
β-strand	571-572	2	4
β-strand	574-575	2	7
β-strand	585-591	7	7
α-helix	597-600	4
β-strand	603-609	7	7
β-strand	617-618	2	7
β-strand	626-628	3	8
β-strand	631-633	3	8
α-helix	641-643	3
β-strand	648-652	5	9
β-strand	658-662	5	9
β-strand	668-674	7	9
α-helix	684-685	2
β-strand	686-692	7	9
β-strand	699-705	7	10
β-strand	708-716	9	10
β-strand	722-731	10	10
β-strand	737-749	13	10
β-strand	753-759	7	1
β-strand	762-769	8	1
β-strand	774	1	2
α-helix	775	1
β-strand	778-785	8	1
α-helix	786-790	5

Chain B: 12 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	323	1	11
α-helix	324-326	3
β-strand	327-330	4	11
β-strand	334	1	12
β-strand	345-353	9	13
β-strand	359-366	8	13
β-strand	376-383	8	13
β-strand	394-397	4	13
α-helix	399-401	3
α-helix	408-410	3
β-strand	414-422	9	14
β-strand	429-436	8	14
α-helix	441-443	3
β-strand	453-456	4	15
β-strand	459-464	6	15
β-strand	465-466	2	16
α-helix	472	1
β-strand	473-475	3	15
α-helix	477-479	3
β-strand	480-482	3	15
β-strand	488-493	6	15
α-helix	500-502	3
β-strand	507-510	4	15
β-strand	513-517	5	15
β-strand	528-529	2	16
β-strand	535-541	7	14
α-helix	549-551	3
β-strand	552-553	2	14
α-helix	555-558	4
β-strand	566-568	3	17
β-strand	571-572	2	14
β-strand	574-575	2	17
β-strand	585-591	7	17
α-helix	597-600	4
β-strand	603-609	7	17
β-strand	617-618	2	17
β-strand	626-628	3	18
β-strand	631-633	3	18
α-helix	641-643	3
β-strand	645-652	8	19
β-strand	658-664	7	19
β-strand	668-674	7	19
β-strand	686-692	7	19
β-strand	699-705	7	20
β-strand	708-716	9	20
β-strand	722-731	10	20
β-strand	737-749	13	20
β-strand	753-759	7	11
β-strand	762-769	8	11
β-strand	774	1	12
β-strand	778-785	8	11
α-helix	786-790	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sialidase A	A, B	protein	477	Streptococcus pneumoniae	P62576 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3H71_1 Sialidase A (chains A, B)
LPEGAALTEKTDIFESGRNGKPNKDGIKSYRIPALLKTDKGTLIAGADERRLHSSDWGDI
GMVIRRSEDNGKTWGDRVTITNLRDNPKASDPSIGSPVNIDMVLVQDPETKRIFSIYDMF
PEGKGIFGMSSQKEEAYKKIDGKTYQILYREGEKGAYTIRENGTVYTPDGKATDYRVVVD
PVKPAYSDKGDLYKGNQLLGNIYFTTNKTSPFRIAKDSYLWMSYSDDDGKTWSAPQDITP
MVKADWMKFLGVGPGTGIVLRNGPHKGRILIPVYTTNNVSHLNGSQSSRIIYSDDHGKTW
HAGEAVNDNRQVDGQKIHSSTMNNRRAQNTESTVVQLNNGDVKLFMRGLTGDLQVATSKD
GGVTWEKDIKRYPQVKDVYVQMSAIHTMHEGKEYIILSNAGGPKRENGMVHLARVEENGE
LTWLKHNPIQKGEFAYNSLQELGNGEYGILYEHTEKGQNAYTLSFRKFNWDFLSKDL

Primary citation

Crystal structures of respiratory pathogen neuraminidases. Hsiao, Y.-S., Parker, D., Ratner, A.J. et al. Biochem Biophys Res Commun (2009) 380:467-471. DOI 10.1016/j.bbrc.2009.01.108 · PubMed

Other PDB entries of the same protein (UniProt P62576 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W20 1.49 Å, Structure of the catalytic domain of the native NanA sialidase from Streptococcus…
3H72 1.7 Å, Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in…
3H73 1.7 Å, Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in…
6QZH 2.1 Å, Structure of the human CC Chemokine Receptor 7 in complex with the intracellular…

Browse structure collections

About this viewer

MolViewer shows 3H71 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.