Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA. Determined by X-ray diffraction at 1.7 Å resolution. Released 12 May 2009.
Explore 3H73 in 3D Show helices and sheets RCSB PDB PDBe
3H73 contains 24 α-helices and 80 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 323 | 1 | 1 |
| α-helix | 324-326 | 3 | |
| β-strand | 327-330 | 4 | 1 |
| β-strand | 334 | 1 | 2 |
| β-strand | 345-353 | 9 | 3 |
| β-strand | 359-366 | 8 | 3 |
| β-strand | 376-383 | 8 | 3 |
| β-strand | 394-397 | 4 | 3 |
| α-helix | 399-401 | 3 | |
| α-helix | 408-410 | 3 | |
| β-strand | 414-422 | 9 | 4 |
| β-strand | 429-436 | 8 | 4 |
| α-helix | 441-444 | 4 | |
| β-strand | 453-455 | 3 | 5 |
| β-strand | 460-464 | 5 | 5 |
| β-strand | 465 | 1 | 6 |
| α-helix | 472 | 1 | |
| β-strand | 473-475 | 3 | 5 |
| α-helix | 477-479 | 3 | |
| β-strand | 480-482 | 3 | 5 |
| β-strand | 488-493 | 6 | 5 |
| α-helix | 500-502 | 3 | |
| β-strand | 507-510 | 4 | 5 |
| β-strand | 513-517 | 5 | 5 |
| β-strand | 529 | 1 | 6 |
| β-strand | 535-541 | 7 | 4 |
| α-helix | 549-551 | 3 | |
| β-strand | 552-553 | 2 | 4 |
| α-helix | 555-558 | 4 | |
| β-strand | 566-568 | 3 | 7 |
| β-strand | 571-572 | 2 | 4 |
| β-strand | 574-575 | 2 | 7 |
| β-strand | 585-591 | 7 | 7 |
| α-helix | 597-600 | 4 | |
| β-strand | 603-609 | 7 | 7 |
| β-strand | 617-618 | 2 | 7 |
| β-strand | 626-628 | 3 | 8 |
| β-strand | 631-633 | 3 | 8 |
| α-helix | 641-643 | 3 | |
| β-strand | 648-652 | 5 | 9 |
| β-strand | 658-662 | 5 | 9 |
| β-strand | 668-674 | 7 | 9 |
| β-strand | 686-692 | 7 | 9 |
| β-strand | 699-705 | 7 | 10 |
| β-strand | 708-716 | 9 | 10 |
| β-strand | 722-731 | 10 | 10 |
| β-strand | 737-749 | 13 | 10 |
| β-strand | 753-759 | 7 | 1 |
| β-strand | 762-769 | 8 | 1 |
| β-strand | 774 | 1 | 2 |
| α-helix | 775 | 1 | |
| β-strand | 778-785 | 8 | 1 |
| α-helix | 786-789 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 323 | 1 | 11 |
| α-helix | 324-326 | 3 | |
| β-strand | 327-330 | 4 | 11 |
| β-strand | 334 | 1 | 12 |
| β-strand | 345-353 | 9 | 13 |
| β-strand | 359-366 | 8 | 13 |
| β-strand | 376-383 | 8 | 13 |
| β-strand | 394-397 | 4 | 13 |
| α-helix | 399-401 | 3 | |
| α-helix | 408-410 | 3 | |
| β-strand | 414-422 | 9 | 14 |
| β-strand | 429-436 | 8 | 14 |
| α-helix | 441-444 | 4 | |
| β-strand | 453-456 | 4 | 15 |
| β-strand | 459-464 | 6 | 15 |
| β-strand | 465-466 | 2 | 16 |
| β-strand | 473-475 | 3 | 15 |
| α-helix | 477-479 | 3 | |
| β-strand | 480-482 | 3 | 15 |
| β-strand | 488-493 | 6 | 15 |
| α-helix | 500-502 | 3 | |
| β-strand | 507-510 | 4 | 15 |
| β-strand | 513-517 | 5 | 15 |
| β-strand | 528-529 | 2 | 16 |
| β-strand | 535-541 | 7 | 14 |
| α-helix | 549-551 | 3 | |
| β-strand | 552-553 | 2 | 14 |
| α-helix | 555-558 | 4 | |
| β-strand | 566-568 | 3 | 17 |
| β-strand | 571-572 | 2 | 14 |
| β-strand | 574-575 | 2 | 17 |
| β-strand | 585-591 | 7 | 17 |
| α-helix | 597-600 | 4 | |
| β-strand | 603-609 | 7 | 17 |
| β-strand | 617-618 | 2 | 17 |
| β-strand | 627-628 | 2 | 18 |
| β-strand | 631-632 | 2 | 18 |
| β-strand | 648-652 | 5 | 19 |
| β-strand | 658-662 | 5 | 19 |
| β-strand | 668-674 | 7 | 19 |
| β-strand | 686-692 | 7 | 19 |
| β-strand | 699-705 | 7 | 20 |
| β-strand | 708-716 | 9 | 20 |
| β-strand | 722-731 | 10 | 20 |
| β-strand | 737-749 | 13 | 20 |
| β-strand | 753-759 | 7 | 11 |
| β-strand | 762-769 | 8 | 11 |
| β-strand | 774 | 1 | 12 |
| α-helix | 775 | 1 | |
| β-strand | 778-785 | 8 | 11 |
| α-helix | 786-790 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sialidase A | A, B | protein | 477 | Streptococcus pneumoniae | P62576 (AlphaFold model) |
>3H73_1 Sialidase A (chains A, B) LPEGAALTEKTDIFESGRNGKPNKDGIKSYRIPALLKTDKGTLIAGADERRLHSSDWGDI GMVIRRSEDNGKTWGDRVTITNLRDNPKASDPSIGSPVNIDMVLVQDPETKRIFSIYDMF PEGKGIFGMSSQKEEAYKKIDGKTYQILYREGEKGAYTIRENGTVYTPDGKATDYRVVVD PVKPAYSDKGDLYKGNQLLGNIYFTTNKTSPFRIAKDSYLWMSYSDDDGKTWSAPQDITP MVKADWMKFLGVGPGTGIVLRNGPHKGRILIPVYTTNNVSHLNGSQSSRIIYSDDHGKTW HAGEAVNDNRQVDGQKIHSSTMNNRRAQNTESTVVQLNNGDVKLFMRGLTGDLQVATSKD GGVTWEKDIKRYPQVKDVYVQMSAIHTMHEGKEYIILSNAGGPKRENGMVHLARVEENGE LTWLKHNPIQKGEFAYNSLQELGNGEYGILYEHTEKGQNAYTLSFRKFNWDFLSKDL
| ID | Name | Formula | Copies |
|---|---|---|---|
| DAN | 2-deoxy-2,3-dehydro-N-acetyl-neuraminic acid | C11 H17 N O8 | 2 |
Crystal structures of respiratory pathogen neuraminidases. Hsiao, Y.-S., Parker, D., Ratner, A.J. et al. Biochem Biophys Res Commun (2009) 380:467-471. DOI 10.1016/j.bbrc.2009.01.108 · PubMed
Other PDB entries of the same protein (UniProt P62576 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3H73 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.