3H8H: C-terminal domain of human RNF2/RING1B

Structure of the C-terminal domain of human RNF2/RING1B;. Determined by X-ray diffraction at 2.0 Å resolution. Released 23 Jun 2009.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 833
Mol. weight: 13.28 kDa
Ligands: 2PE
Released: 23 Jun 2009

Explore 3H8H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3H8H contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	225-232	8	1
β-strand	246-251	6	1
β-strand	255	1	2
α-helix	256-270	15
α-helix	286-288	3
β-strand	293-296	4	1
β-strand	302-304	3	1
α-helix	305-306	2
β-strand	310	1	2
α-helix	311-318	8
β-strand	325-329	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase RING2	A	protein	112	Homo sapiens	Q99496 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3H8H_1 E3 ubiquitin-protein ligase RING2 (chains A)
GMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGES
NQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYA

Ligands and cofactors

ID	Name	Formula	Copies
2PE	Nonaethylene glycol	C18 H38 O10	1

Water and common crystallization additives (CL, SO4, GOL) are not listed.

Primary citation

Ring1B contains a ubiquitin-like docking module for interaction with Cbx proteins. Bezsonova, I., Walker, J.R., Bacik, J.P. et al. Biochemistry (2009) 48:10542-10548. DOI 10.1021/bi901131u · PubMed

Other PDB entries of the same protein (UniProt Q99496 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3GS2 1.7 Å, Ring1B C-terminal domain/Cbx7 Cbox Complex
3IXS 1.7 Å, Ring1B C-terminal domain/RYBP C-terminal domain Complex
6WI7 1.7 Å, RING1B-BMI1 fusion in closed conformation
4S3O 2.0 Å, PCGF5-RING1B-UbcH5c complex
2H0D 2.5 Å, Structure of a Bmi-1-Ring1B Polycomb group ubiquitin ligase complex
3RPG 2.65 Å, Bmi1/Ring1b-UbcH5c complex structure
28OE 2.74 Å, Human PRC1.4 in complex with native UBCH5C bound to a H3Kc27me3 mononucleosome
9DBY 2.8 Å, ncPRC1RYBP bound to singly modified H2AK119Ub nucleosome
9V9Q 2.8 Å, Cryo-EM structure of the cPRC1-UbcH5c E3-E2 complex bound to the H2BK120ub-modified…
8PP7 2.91 Å, human RYBP-PRC1 bound to mononucleosome
9DGG 2.98 Å, ncPRC1RYBP bound to unmodified nucleosome
9V6S 3.0 Å, Cryo-EM structure of a single cPRC1 complex engaged on one face of an endogenous 147-bp…

Browse structure collections

About this viewer

MolViewer shows 3H8H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.