3H8K: Ubiquitin-conjugating enzyme E2 G2

Crystal structure of Ube2g2 complxed with the G2BR domain of gp78 at 1.8-A resolution. Determined by X-ray diffraction at 1.8 Å resolution. Released 14 Jul 2009.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,741
Mol. weight: 22 kDa
Released: 14 Jul 2009

Explore 3H8K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3H8K contains 10 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	4-18	15
α-helix	20-21	2
β-strand	24-28	5	1
β-strand	36-42	7	1
α-helix	43-44	2
β-strand	53-59	7	1
α-helix	68-69	2
β-strand	70-73	4	1
β-strand	82	1	2
β-strand	87	1	1
β-strand	88	1	2
α-helix	91-93	3
α-helix	95	1
α-helix	116-128	13
α-helix	138-146	9
α-helix	148-163	16

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	575-599	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-conjugating enzyme E2 G2	A	protein	164	Homo sapiens	P60604 (AlphaFold model)
Autocrine motility factor receptor, isoform 2	B	protein	28	Homo sapiens	Q9UKV5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3H8K_1 Ubiquitin-conjugating enzyme E2 G2 (chains A)
AGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFP
LDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILL
SVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL

Sequence of entity 2 (B), FASTA

>3H8K_2 Autocrine motility factor receptor, isoform 2 (chains B)
WSADERQRMLVQRKDELLQQARKRFLNK

Primary citation

Allosteric activation of E2-RING finger-mediated ubiquitylation by a structurally defined specific E2-binding region of gp78. Das, R., Mariano, J., Tsai, Y.C. et al. Mol Cell (2009) 34:674-685. DOI 10.1016/j.molcel.2009.05.010 · PubMed

Other PDB entries of the same protein (UniProt P60604 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LEW 1.74 Å, Crystal structure of UBE2G2 in complex with the UBE2G2-binding region of AUP1
8T0S 1.95 Å, Crystal structure of UBE2G2 adduct with phenethyl isothiocyanate (PEITC) at the Cys48…
4LAD 2.3 Å, Crystal Structure of the Ube2g2:RING-G2BR complex
2CYX 2.56 Å, Structure of human ubiquitin-conjugating enzyme E2 G2 (UBE2G2/UBC7)
2KLY Solution structure of human ubiquitin conjugating enzyme Ube2g2
2LXP NMR structure of two domains in ubiquitin ligase gp78, RING and G2BR, bound to its…

Browse structure collections

About this viewer

MolViewer shows 3H8K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.