3H91: Chromobox protein homolog 2

Crystal structure of the complex of human chromobox homolog 2 (CBX2) and H3K27 peptide. Determined by X-ray diffraction at 1.5 Å resolution. Released 18 Aug 2009.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,206
Mol. weight: 16.05 kDa
Released: 18 Aug 2009

Explore 3H91 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3H91 contains 6 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	11-13	3	1
β-strand	14-23	10	2
β-strand	26-33	8	2
α-helix	38-40	3
β-strand	42-45	4	2
α-helix	46-48	3
β-strand	49	1	1
α-helix	52-59	8

Chain B: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	11-13	3	3
β-strand	14-23	10	4
β-strand	26-33	8	4
α-helix	38-40	3
β-strand	42-45	4	4
α-helix	46-48	3
β-strand	49	1	3
α-helix	53-58	6

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	24-26	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 2	A, B	protein	54	Homo sapiens	Q14781 (AlphaFold model)
H3K27 peptide	C, D	protein	15		Q92133 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3H91_1 Chromobox protein homolog 2 (chains A, B)
EQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKE

Sequence of entity 2 (C, D), FASTA

>3H91_2 H3K27 peptide (chains C, D)
QLATKAARKSAPATG

Primary citation

Recognition and specificity determinants of the human cbx chromodomains. Kaustov, L., Ouyang, H., Amaya, M. et al. J Biol Chem (2011) 286:521-529. DOI 10.1074/jbc.M110.191411 · PubMed

Other PDB entries of the same protein (UniProt Q14781 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EPK 1.8 Å, Crystal Structure of chromodomain of CBX2 in complex with inhibitor UNC3866
2D9U Solution structure of the Chromo domain of chromobox homolog 2 from human

Browse structure collections

About this viewer

MolViewer shows 3H91 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.