5EPK: Chromodomain of CBX2

Crystal Structure of chromodomain of CBX2 in complex with inhibitor UNC3866. Determined by X-ray diffraction at 1.8 Å resolution. Released 23 Dec 2015.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 569
Mol. weight: 7.36 kDa
Released: 23 Dec 2015

Explore 5EPK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EPK contains 3 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	1
β-strand	14-23	10	2
β-strand	26-33	8	2
α-helix	38-40	3
β-strand	42-45	4	2
α-helix	46-48	3
α-helix	53-60	8

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-4	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 2	A	protein	55	Homo sapiens	Q14781 (AlphaFold model)
unc3866	B	protein	6	Homo sapiens

Sequence of entity 1 (A), FASTA

>5EPK_1 Chromobox protein homolog 2 (chains A)
GEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKE

Sequence of entity 2 (B), FASTA

>5EPK_2 unc3866 (chains B)
XFALXX

Primary citation

A cellular chemical probe targeting the chromodomains of Polycomb repressive complex 1. Stuckey, J.I., Dickson, B.M., Cheng, N. et al. Nat Chem Biol (2016) 12:180-187. DOI 10.1038/nchembio.2007 · PubMed

Other PDB entries of the same protein (UniProt Q14781 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3H91 1.5 Å, Crystal structure of the complex of human chromobox homolog 2 (CBX2) and H3K27 peptide
2D9U Solution structure of the Chromo domain of chromobox homolog 2 from human

Browse structure collections

About this viewer

MolViewer shows 5EPK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.