Crystal Structure of Human Fibroblast Growth Factor Homologous Factor 2A (FHF2A), also referred to as Fibroblast Growth Factor 13A (FGF13A). Determined by X-ray diffraction at 1.9 Å resolution. Released 26 May 2009.
Explore 3HBW in 3D Show helices and sheets RCSB PDB PDBe
3HBW contains 12 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 66-75 | 10 | 1 |
| β-strand | 80-83 | 4 | 1 |
| β-strand | 89-92 | 4 | 1 |
| α-helix | 98-100 | 3 | |
| β-strand | 102-108 | 7 | 1 |
| β-strand | 111-116 | 6 | 1 |
| α-helix | 121 | 1 | |
| β-strand | 122-125 | 4 | 1 |
| β-strand | 131-134 | 4 | 1 |
| β-strand | 137 | 1 | 2 |
| α-helix | 139-141 | 3 | |
| β-strand | 142-148 | 7 | 1 |
| β-strand | 152-161 | 10 | 1 |
| β-strand | 168-170 | 3 | 1 |
| β-strand | 173 | 1 | 3 |
| β-strand | 178 | 1 | 1 |
| β-strand | 179 | 1 | 3 |
| α-helix | 182-184 | 3 | |
| α-helix | 190-192 | 3 | |
| β-strand | 194-204 | 11 | 1 |
| α-helix | 205-208 | 4 | |
| β-strand | 209 | 1 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1066-1075 | 10 | 4 |
| β-strand | 1080-1083 | 4 | 4 |
| β-strand | 1089-1092 | 4 | 4 |
| α-helix | 1098-1100 | 3 | |
| β-strand | 1102-1108 | 7 | 4 |
| β-strand | 1111-1116 | 6 | 4 |
| α-helix | 1121 | 1 | |
| β-strand | 1122-1125 | 4 | 4 |
| β-strand | 1131-1134 | 4 | 4 |
| β-strand | 1137 | 1 | 5 |
| α-helix | 1139-1141 | 3 | |
| β-strand | 1142-1148 | 7 | 4 |
| β-strand | 1152-1161 | 10 | 4 |
| β-strand | 1168-1170 | 3 | 4 |
| β-strand | 1173 | 1 | 6 |
| β-strand | 1178 | 1 | 4 |
| β-strand | 1179 | 1 | 6 |
| α-helix | 1182-1184 | 3 | |
| α-helix | 1190-1192 | 3 | |
| β-strand | 1194-1204 | 11 | 4 |
| α-helix | 1205-1208 | 4 | |
| β-strand | 1209 | 1 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fibroblast growth factor 13 | A, B | protein | 193 | Homo sapiens | Q92913 (AlphaFold model) |
>3HBW_1 Fibroblast growth factor 13 (chains A, B) GSKKRRRRRPEPQLKGIVTKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVV AIQGVQTKLYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIYRQQQSGRGWYLG LNKEGEIMKGNHVKKNKPAAHFLPKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGV LNGGKSMSHNEST
Crystal structure of a fibroblast growth factor homologous factor (FHF) defines a conserved surface on FHFs for binding and modulation of voltage-gated sodium channels. Goetz, R., Dover, K., Laezza, F. et al. J Biol Chem (2009) 284:17883-17896. DOI 10.1074/jbc.M109.001842 · PubMed
Other PDB entries of the same protein (UniProt Q92913 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3HBW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.