Human prion protein variant F198S with V129. Determined by X-ray diffraction at 1.85 Å resolution. Released 12 Jan 2010.
Explore 3HER in 3D Show helices and sheets RCSB PDB PDBe
3HER contains 14 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 129-130 | 2 | 1 |
| α-helix | 131-133 | 3 | |
| α-helix | 135-139 | 5 | |
| α-helix | 144-153 | 10 | |
| α-helix | 154-156 | 3 | |
| β-strand | 162-163 | 2 | 1 |
| α-helix | 164-166 | 3 | |
| α-helix | 172-190 | 19 | |
| α-helix | 200-222 | 23 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 129-130 | 2 | 2 |
| α-helix | 131-133 | 3 | |
| α-helix | 135-138 | 4 | |
| α-helix | 144-153 | 10 | |
| α-helix | 154-156 | 3 | |
| β-strand | 162-163 | 2 | 2 |
| α-helix | 164-166 | 3 | |
| α-helix | 172-189 | 18 | |
| α-helix | 200-226 | 27 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Major prion protein | A, B | protein | 142 | Homo sapiens | P04156 (AlphaFold model) |
>3HER_1 Major prion protein (chains A, B) GQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYVLGSAMSRPIIHFGSDYEDRY YRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENSTETDVKMMERV VEQMCITQYERESQAYYQRGSS
| ID | Name | Formula | Copies |
|---|---|---|---|
| CD | Cadmium ion | Cd | 2 |
Conformational diversity in prion protein variants influences intermolecular beta-sheet formation. Lee, S., Antony, L., Hartmann, R. et al. EMBO J (2010) 29:251-262. DOI 10.1038/emboj.2009.333 · PubMed
Other PDB entries of the same protein (UniProt P04156 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3HER directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.