3HK3: Murine thrombin mutant W215A/E217A

Crystal structure of murine thrombin mutant W215A/E217A (one molecule in the asymmetric unit). Determined by X-ray diffraction at 1.94 Å resolution. Released 7 Jul 2009.

Method: X-ray diffraction
Resolution: 1.94 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,528
Mol. weight: 34.9 kDa
Released: 7 Jul 2009

Explore 3HK3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HK3 contains 16 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
α-helix	14C-14H	6

Chain B: 14 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-35	6	3
β-strand	39-46	8	3
β-strand	51-54	4	3
α-helix	56-58	3
β-strand	60-60A	2	4
α-helix	60B-60D	3
β-strand	60F-60G	2	4
α-helix	61-63	3
β-strand	64-68	5	3
β-strand	72	1	5
β-strand	81-90	10	3
β-strand	104-108	5	3
α-helix	111-114	4
α-helix	120-121	2
β-strand	122	1	2
α-helix	123-124	2
α-helix	126-129C	7
β-strand	135-140	6	2
β-strand	154	1	5
β-strand	156-162	7	2
α-helix	163-164	2
α-helix	165-170	6
β-strand	180-183	4	2
β-strand	189	1	1
α-helix	192-194	3
β-strand	198-202	5	2
β-strand	207-215	9	2
α-helix	220-221A	3
β-strand	226-230	5	2
α-helix	232-234	3
α-helix	235-245	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thrombin light chain	A	protein	44	Mus musculus	P19221 (AlphaFold model)
Thrombin heavy chain	B	protein	258	Mus musculus	P19221 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3HK3_1 Thrombin light chain (chains A)
FHTFFNEKTFGLGEADCGLRPLFEKKSLKDTTEKELLDSYIDGR

Sequence of entity 2 (B), FASTA

>3HK3_2 Thrombin heavy chain (chains B)
IVEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPWDKNFTENDLL
VRIGKHSRTRYERNVEKISMLEKIYVHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVCL
PDKQTVTSLLRAGYKGRVTGWGNLRETWTTNINEIQPSVLQVVNLPIVERPVCKASTRIR
ITDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSAGAGCDRKGKYGFY
THVFRLKRWIQKVIDQFG

Primary citation

Mechanism of the Anticoagulant Activity of Thrombin Mutant W215A/E217A. Gandhi, P.S., Page, M.J., Chen, Z. et al. J Biol Chem (2009) 284:24098-24105. DOI 10.1074/jbc.M109.025403 · PubMed

Other PDB entries of the same protein (UniProt P19221 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PUX 2.0 Å, Crystal structure of murine thrombin in complex with the extracellular fragment of…
2OCV 2.2 Å, Structural basis of Na+ activation mimicry in murine thrombin
3HKI 2.2 Å, Crystal structure of murine thrombin mutant W215A/E217A in complex with the…
3EDX 2.4 Å, Crystal structure of the W215A/E217A mutant of murine thrombin
3HK6 3.2 Å, Crystal structure of murine thrombin mutant W215A/E217A (two molecules in the asymmetric…
2PV9 3.5 Å, Crystal structure of murine thrombin in complex with the extracellular fragment of…

Browse structure collections

About this viewer

MolViewer shows 3HK3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.