Crystal structure of murine thrombin mutant W215A/E217A (two molecules in the asymmetric unit). Determined by X-ray diffraction at 3.2 Å resolution. Released 7 Jul 2009.
Explore 3HK6 in 3D Show helices and sheets RCSB PDB PDBe
3HK6 contains 29 α-helices and 45 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1J-1G | 4 | |
| α-helix | 1C-1A | 3 | |
| α-helix | 8-10 | 3 | |
| α-helix | 14C-14G | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 20-21 | 2 | 2 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-35 | 6 | 3 |
| β-strand | 40-48 | 9 | 3 |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 60B-60D | 3 | |
| α-helix | 61-63 | 3 | |
| β-strand | 64-68 | 5 | 3 |
| β-strand | 72 | 1 | 4 |
| β-strand | 81-90 | 10 | 3 |
| β-strand | 104-108 | 5 | 3 |
| α-helix | 112-114 | 3 | |
| α-helix | 120-121 | 2 | |
| β-strand | 122 | 1 | 2 |
| α-helix | 126-129C | 7 | |
| β-strand | 132 | 1 | 2 |
| β-strand | 135-140 | 6 | 2 |
| β-strand | 149C | 1 | 5 |
| β-strand | 149E | 1 | 5 |
| β-strand | 154 | 1 | 4 |
| β-strand | 156-162 | 7 | 2 |
| α-helix | 165-170 | 6 | |
| β-strand | 180-183 | 4 | 2 |
| β-strand | 189 | 1 | 1 |
| α-helix | 192-194 | 3 | |
| β-strand | 198-202 | 5 | 2 |
| β-strand | 207-215 | 9 | 2 |
| β-strand | 226-230 | 5 | 2 |
| α-helix | 232-234 | 3 | |
| α-helix | 235-245 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1J-1G | 4 | |
| α-helix | 14C-14H | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 6 |
| β-strand | 21 | 1 | 7 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-35 | 6 | 8 |
| β-strand | 40-48 | 9 | 8 |
| β-strand | 51-54 | 4 | 8 |
| α-helix | 56-58 | 3 | |
| β-strand | 60-60A | 2 | 9 |
| α-helix | 60B-60D | 3 | |
| β-strand | 60F-60G | 2 | 9 |
| α-helix | 61-63 | 3 | |
| β-strand | 64-68 | 5 | 8 |
| β-strand | 72 | 1 | 10 |
| β-strand | 81-90 | 10 | 8 |
| β-strand | 104-108 | 5 | 8 |
| α-helix | 111-113 | 3 | |
| α-helix | 120-121 | 2 | |
| β-strand | 122 | 1 | 7 |
| α-helix | 123-124 | 2 | |
| α-helix | 126-129C | 7 | |
| β-strand | 135-140 | 6 | 7 |
| β-strand | 147 | 1 | 11 |
| β-strand | 149 | 1 | 11 |
| β-strand | 149C | 1 | 12 |
| β-strand | 149E | 1 | 12 |
| β-strand | 154 | 1 | 10 |
| β-strand | 156-162 | 7 | 7 |
| α-helix | 163-164 | 2 | |
| α-helix | 165-171 | 7 | |
| β-strand | 180-183 | 4 | 7 |
| β-strand | 189 | 1 | 6 |
| β-strand | 198-202 | 5 | 7 |
| β-strand | 207-215 | 9 | 7 |
| α-helix | 220-221A | 3 | |
| β-strand | 226-230 | 5 | 7 |
| α-helix | 232-234 | 3 | |
| α-helix | 235-245 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thrombin light chain | A, C | protein | 44 | Mus musculus | P19221 (AlphaFold model) |
| Thrombin heavy chain | B, D | protein | 258 | Mus musculus | P19221 (AlphaFold model) |
>3HK6_1 Thrombin light chain (chains A, C) FHTFFNEKTFGLGEADCGLRPLFEKKSLKDTTEKELLDSYIDGR
>3HK6_2 Thrombin heavy chain (chains B, D) IVEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPWDKNFTENDLL VRIGKHSRTRYERNVEKISMLEKIYVHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVCL PDKQTVTSLLRAGYKGRVTGWGNLRETWTTNINEIQPSVLQVVNLPIVERPVCKASTRIR ITDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSAGAGCDRKGKYGFY THVFRLKRWIQKVIDQFG
Mechanism of the Anticoagulant Activity of Thrombin Mutant W215A/E217A. Gandhi, P.S., Page, M.J., Chen, Z. et al. J Biol Chem (2009) 284:24098-24105. DOI 10.1074/jbc.M109.025403 · PubMed
Other PDB entries of the same protein (UniProt P19221 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3HK6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.