3HQB: Human desarg-C5A

Crystal structure of human desarg-C5A. Determined by X-ray diffraction at 3.3 Å resolution. Released 2 Feb 2010.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 957
Mol. weight: 16.32 kDa
Released: 2 Feb 2010

Explore 3HQB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HQB contains 7 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	3-11	9
α-helix	16-26	11
α-helix	34-39	6
α-helix	44-62	19

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	7-26	20
α-helix	34-39	6
α-helix	44-61	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C5	A, B	protein	73	Homo sapiens	P01031 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3HQB_1 Complement C5 (chains A, B)
MLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQ
LRANISHKDMQLG

Primary citation

Structure of human desArg-C5a. Cook, W.J., Galakatos, N., Boyar, W.C. et al. Acta Crystallogr D Biol Crystallogr (2010) 66:190-197. DOI 10.1107/S0907444909049051 · PubMed

Other PDB entries of the same protein (UniProt P01031 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y6C 2.0 Å, X-ray structure analysis of human Complement Component 5 TE domain in complex with the…
5B71 2.11 Å, Crystal structure of complement C5 in complex with SKY59
4UU9 2.12 Å, Crystal structure of the human c5a in complex with MEDI7814 a neutralising antibody
7AD7 2.3 Å, Crystal structure of human complement C5 in complex with the K8 bovine knob domain…
5B4P 2.4 Å, Complex structure of human C5a and its binding repebody
4P39 2.4 Å, Crystal structure of the human C5aR antagonist C5a-A8
7OP0 2.57 Å, Crystal structure of complement C5 in complex with chemically synthesized K92 knob domain.
3HQA 2.59 Å, Crystal structure of human desarg-C5A
5HCC 2.59 Å, Ternary complex of human Complement C5 with Ornithodoros moubata OmCI and Dermacentor…
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
6RPT 2.7 Å, Structure of tick complement inhibitor CirpT1 complexed with macroglobubulin domain 4 of…
7AD6 2.75 Å, Crystal structure of human complement C5 in complex with the K92 bovine knob domain…

Browse structure collections

About this viewer

MolViewer shows 3HQB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.