PHD2:Mn:NOG:HIF1-alpha substrate complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Jul 2009.
Explore 3HQR in 3D Show helices and sheets RCSB PDB PDBe
3HQR contains 12 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 190-193 | 4 | |
| α-helix | 194-198 | 5 | |
| α-helix | 199-205 | 7 | |
| β-strand | 207-210 | 4 | 1 |
| α-helix | 215-231 | 17 | |
| β-strand | 236-237 | 2 | 1 |
| β-strand | 240 | 1 | 2 |
| α-helix | 248-250 | 3 | |
| β-strand | 252 | 1 | 3 |
| β-strand | 255-259 | 5 | 1 |
| α-helix | 267-282 | 16 | |
| β-strand | 292-295 | 4 | 1 |
| α-helix | 296-297 | 2 | |
| β-strand | 298-303 | 6 | 1 |
| β-strand | 308-313 | 6 | 3 |
| β-strand | 322-329 | 8 | 1 |
| β-strand | 331 | 1 | 4 |
| α-helix | 336-339 | 4 | |
| β-strand | 340 | 1 | 3 |
| β-strand | 343-345 | 3 | 3 |
| β-strand | 354-356 | 3 | 3 |
| β-strand | 359 | 1 | 4 |
| β-strand | 363-367 | 5 | 1 |
| β-strand | 374-379 | 6 | 3 |
| β-strand | 383-392 | 10 | 1 |
| α-helix | 393-404 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 559-561 | 3 | |
| β-strand | 564 | 1 | 2 |
| α-helix | 565 | 1 | |
| α-helix | 571 | 1 | |
| β-strand | 572-573 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Egl nine homolog 1 | A | protein | 246 | Homo sapiens | Q9GZT9 (AlphaFold model) |
| Hypoxia-inducible factor 1 alpha | S | protein | 17 | Homo sapiens | Q16665 (AlphaFold model) |
>3HQR_1 Egl nine homolog 1 (chains A) PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQL VSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMV ACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKF DRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERAAAKVKYLTGEKGVRVELNKPSDS VGKDVF
>3HQR_2 Hypoxia-inducible factor 1 alpha (chains S) DLEMLAPYIPMDDDFQL
Structural basis for binding of hypoxia-inducible factor to the oxygen-sensing prolyl hydroxylases. Chowdhury, R., McDonough, M.A., Mecinovic, J. et al. Structure (2009) 17:981-989. DOI 10.1016/j.str.2009.06.002 · PubMed
Other PDB entries of the same protein (UniProt Q9GZT9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3HQR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.