3HXR: Nucleoporin Nup120 from S.cerevisiae

Nucleoporin Nup120 from S.cerevisiae (aa 1-757). Determined by X-ray diffraction at 3.0 Å resolution. Released 28 Jul 2009.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 5,313
Mol. weight: 88.07 kDa
Released: 28 Jul 2009

Explore 3HXR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HXR contains 20 α-helices and 39 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
β-strand	4-10	7	2
β-strand	23-26	4	3
β-strand	56-61	6	3
β-strand	67-72	6	3
β-strand	78-83	6	3
β-strand	92-96	5	3
β-strand	101	1	4
β-strand	108-112	5	5
β-strand	116-122	7	5
β-strand	123	1	4
β-strand	128-134	7	5
α-helix	135-139	5
β-strand	153	1	5
β-strand	158	1	6
β-strand	161	1	6
β-strand	165-169	5	7
β-strand	173-177	5	7
β-strand	183-186	4	7
β-strand	205	1	7
β-strand	223-229	7	8
β-strand	233-238	6	8
β-strand	243-244	2	8
β-strand	247	1	9
β-strand	249	1	9
β-strand	258	1	10
β-strand	260	1	10
β-strand	280-283	4	11
β-strand	286-291	6	11
β-strand	297-301	5	11
β-strand	321	1	11
β-strand	330-337	8	12
β-strand	349-357	9	12
β-strand	360-368	9	12
α-helix	370-373	4
β-strand	376-379	4	12
β-strand	380	1	1
β-strand	385	1	2
α-helix	386-392	7
α-helix	404-414	11
α-helix	417-429	13
α-helix	440-457	18
β-strand	460-466	7	2
β-strand	470-475	6	2
β-strand	480-486	7	2
α-helix	487-488	2
α-helix	489-495	7
α-helix	506-517	12
α-helix	522-537	16
α-helix	546-553	8
α-helix	554-558	5
α-helix	564-574	11
α-helix	579-585	7
α-helix	586-591	6
α-helix	610-639	30
α-helix	648-669	22
α-helix	672-682	11
α-helix	695-710	16
α-helix	719-729	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoporin NUP120	A	protein	761	Saccharomyces cerevisiae	P35729 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3HXR_1 Nucleoporin NUP120 (chains A)
GPGSMACLSRIDANLLQYYEKPEPNNTVDLYVSNNSNNNGLKEGDKSISTPVPQPYGSEY
SNCLLLSNSEYICYHFSSRSTLLTFYPLSDAYHGKTINIHLPNASMNQRYTLTIQEVEQQ
LLVNVILKDGSFLTLQLPLSFLFSSANTLNGEWFHLQNPYDFTVRVPHFLFYVSPQFSVV
FLEDGGLLGLKKVDGVHYEPLLFNDNSYLKSLTRFFSRSSKSDYDSVISCKLFHERYLIV
LTQNCHLKIWDLTSFTLIQDYDMVSQSDSDPSHFRKVEAVGEYLSLYNNTLVTLLPLENG
LFQMGTLLVDSSGILTYTFQNNIPTNLSASAIWSIVDLVLTRPLELNVEASYLNLIVLWK
SGTASKLQILNVNDESFKNYEWIESVNKSLVDLQSEHDLDIVTKTGDVERGFCNLKSRYG
TQIFERAQQILSENKIIMAHNEDEEYLANLETILRDVKTAFNEASSITLYGDEIILVNCF
QPYNHSLYKLNTTVENWFYNMHSETDGSELFKYLRTLNGFASTLSNDVLRSISKKFLDII
TGELPDSMTTVEKFTDIFKNCLENQFEITNLKILFDELNSFDIPVVLNDLINNQMKPGIF
WKKDFISAIKFDGFTSIISLESLHQLLSIHYRITLQVLLTFVLFDLDTEIFGQHISTLLD
LHYKQFLLLNLYRQDKCLLAEVLLKDSSEFSFGVKFFNYGQLIAYIDSLNSNVYNASITE
NSFFMTFFRSYIIENTSHKNIRFFLENVECPFYLRHNEVQE

Primary citation

The structure of the scaffold nucleoporin Nup120 reveals a new and unexpected domain architecture. Leksa, N.C., Brohawn, S.G., Schwartz, T.U. Structure (2009) 17:1082-1091. DOI 10.1016/j.str.2009.06.003 · PubMed

Other PDB entries of the same protein (UniProt P35729 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3F7F 2.6 Å, Structure of Nup120
3H7N 3.0 Å, Structure of Nup120
6X06 4.27 Å, Nup120 (aa1-757) from S. cerevisiae bound by VHH-SAN11
4XMM 7.38 Å, Structure of the yeast coat nucleoporin complex, space group C2
4XMN 7.6 Å, Structure of the yeast coat nucleoporin complex, space group P212121
8TIE 8.1 Å, Double nuclear outer ring of Nup84-complexes from the yeast NPC
7N84 11.6 Å, Double nuclear outer ring from the isolated yeast NPC
7N9F 37.0 Å, Structure of the in situ yeast NPC
8ZZ1 Structure of the Nup84 sub-complex of the Nuclear Pore Complex
8ZZA Integrative structure and functional anatomy of a single spoke of a nuclear pore complex
8ZZB Integrative structure and functional anatomy of three spokes of a nuclear pore complex
8ZZC Integrative structure and functional anatomy of eight spokes of a nuclear pore complex

Browse structure collections

About this viewer

MolViewer shows 3HXR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.