3I3C: Crystal Structural of CBX5 Chromo Shadow Domain

Crystal Structural of CBX5 Chromo Shadow Domain. Determined by X-ray diffraction at 2.48 Å resolution. Released 18 Aug 2009.

Method: X-ray diffraction
Resolution: 2.48 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,817
Mol. weight: 33.86 kDa
Released: 18 Aug 2009

Explore 3I3C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3I3C contains 13 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	18-21	4
β-strand	25-32	8	1
β-strand	39-44	6	1
β-strand	50-54	5	1
α-helix	55-61	7
α-helix	63-70	8

Chain B: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	18-21	4
β-strand	25-33	9	2
β-strand	38-44	7	2
β-strand	50-54	5	2
α-helix	55-61	7
α-helix	63-70	8

Chain C: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	3
α-helix	18-21	4
α-helix	23-24	2
β-strand	25-32	8	3
β-strand	39-44	6	3
β-strand	50-54	5	3
α-helix	55-61	7
α-helix	63-70	8

Chain D: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	4
α-helix	18-21	4
β-strand	25-33	9	4
β-strand	38-44	7	4
β-strand	50-54	5	4
α-helix	55-61	7
α-helix	63-71	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 5	A, B, C, D	protein	75	Homo sapiens	P45973 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3I3C_1 Chromobox protein homolog 5 (chains A, B, C, D)
SSGRENLYFQGSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANV
KCPQIVIAFYEERLT

Primary citation

Crystal Structural of CBX5 Chromo Shadow Domain. Li, Z., Li, Y., Amaya, M.F. et al. To be published.

Other PDB entries of the same protein (UniProt P45973 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FDT 2.0 Å, Crystal structure of the complex of human chromobox homolog 5 (CBX5) with H3K9(me)3…
9CEA 2.15 Å, Crystal structure of HP1alpha chromoshadow domain
9CDW 2.4 Å, Crystal structure of HP1alpha chromoshadow domain in complex with KAP1 peptide
9CMT 3.17 Å, The crystal structure of HP1alpha CSD-Agno complex
8UXQ 6.3 Å, Structure of Heterochromatin Protein 1 (HP1) alpha in complex with an H2A.Z nucleosome

Browse structure collections

About this viewer

MolViewer shows 3I3C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.