3I40: Human insulin

Human insulin. Determined by X-ray diffraction at 1.85 Å resolution. Released 5 Jan 2010.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 446
Mol. weight: 5.79 kDa
Released: 5 Jan 2010

Explore 3I40 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3I40 contains 5 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	2	1
α-helix	3-7	5
α-helix	13-17	5
β-strand	20	1	1

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	9-19	11
α-helix	20-22	3
β-strand	24	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin A chain	A	protein	21	Homo sapiens	P01308 (AlphaFold model)
Insulin B chain	B	protein	30	Homo sapiens	P01308 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3I40_1 Insulin A chain (chains A)
GIVEQCCTSICSLYQLENYCN

Sequence of entity 2 (B), FASTA

>3I40_2 Insulin B chain (chains B)
FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Primary citation

X-ray investigation of gene-engineered human insulin crystallized from a solution containing polysialic acid. Timofeev, V.I., Chuprov-Netochin, R.N., Samigina, V.R. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2010) 66:259-263. DOI 10.1107/S1744309110000461 · PubMed

Other PDB entries of the same protein (UniProt P01308 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3W7Y 0.92 Å, 0.92A structure of 2Zn human insulin at 100K
5E7W 0.95 Å, X-ray Structure of Human Recombinant 2Zn insulin at 0.92 Angstrom
5HQI 0.97 Å, Insulin with proline analog HzP at position B28 in the T2 state
1MSO 1.0 Å, T6 Human Insulin at 1.0 A Resolution
3HYD 1.0 Å, LVEALYL peptide derived from human insulin chain B, residues 11-17
6VER 1.05 Å, Human insulin analog: [GluB10,TyrB20]-DOI
4FKA 1.08 Å, High resolution structure of the manganese derivative of insulin
3TT8 1.12 Å, Crystal Structure Analysis of Cu Human Insulin Derivative
3W7Z 1.15 Å, 1.15A structure of human 2Zn insulin at 293K
8OKY 1.17 Å, Crystal structure of D-ProB26-DTriA analogue of human insulin
5USP 1.17 Å, Insulin with proline analog Pip at position B28 in the T2 state
5UOZ 1.17 Å, Insulin with proline analog FyP at position B28 in the T2 state

Browse more

3I40 is part of these collections:

Insulin and hormones

About this viewer

MolViewer shows 3I40 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.