3I90: Chromobox protein homolog 6

Crystal structure of human chromobox homolog 6 (CBX6) with H3K27 peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 8 Sept 2009.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,042
Mol. weight: 14.73 kDa
Released: 8 Sept 2009

Explore 3I90 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3I90 contains 7 α-helices and 10 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	1
β-strand	13-22	10	2
β-strand	25-32	8	2
α-helix	37-39	3
β-strand	41-44	4	2
α-helix	45-47	3
α-helix	52-57	6

Chain B: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	11-12	2	3
β-strand	13-22	10	4
β-strand	25-32	8	4
α-helix	37-39	3
β-strand	41-44	4	4
α-helix	45-47	3
α-helix	52-57	6

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	24-26	3	1
α-helix	27-28	2

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	24-25	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 6	A, B	protein	51	Homo sapiens	O95503 (AlphaFold model)
H3K27 peptide	C, D	protein	11

Sequence of entity 1 (A, B), FASTA

>3I90_1 Chromobox protein homolog 6 (chains A, B)
RVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQ

Sequence of entity 2 (C, D), FASTA

>3I90_2 H3K27 peptide (chains C, D)
QLATKAARKSA

Primary citation

Recognition and specificity determinants of the human cbx chromodomains. Kaustov, L., Ouyang, H., Amaya, M. et al. J Biol Chem (2011) 286:521-529. DOI 10.1074/jbc.M110.191411 · PubMed

Other PDB entries of the same protein (UniProt O95503 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3GV6 1.76 Å, Crystal Structure of human chromobox homolog 6 (CBX6) with H3K9 peptide

Browse structure collections

About this viewer

MolViewer shows 3I90 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.