3IGQ: Glr4197 protein

Crystal structure of the extracellular domain of a bacterial pentameric ligand-gated ion channel. Determined by X-ray diffraction at 2.3 Å resolution. Released 8 Dec 2009.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Gloeobacter violaceus
Chains: 6
Atoms: 9,053
Mol. weight: 139.15 kDa
Ligands: HG
Released: 8 Dec 2009

Explore 3IGQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3IGQ contains 30 α-helices and 80 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	11	1	1
β-strand	14	1	1
β-strand	16-28	13	2
β-strand	36-48	13	2
α-helix	50-52	3
α-helix	56-59	4
β-strand	64-65	2	2
α-helix	68-70	3
β-strand	76-78	3	3
β-strand	81	1	2
β-strand	86-94	9	2
β-strand	99-111	13	2
β-strand	123-132	10	3
β-strand	140-144	5	2
α-helix	146-148	3
β-strand	150-151	2	2
β-strand	155-157	3	3
β-strand	160-170	11	3
β-strand	183-192	10	3

Chain B: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
β-strand	16-28	13	4
β-strand	36-48	13	4
α-helix	50-52	3
α-helix	56-59	4
β-strand	64-65	2	4
α-helix	68-70	3
β-strand	76-78	3	5
β-strand	81	1	4
β-strand	86-94	9	4
β-strand	99-111	13	4
β-strand	123-132	10	5
β-strand	140-144	5	4
α-helix	146-148	3
β-strand	150-151	2	4
β-strand	155-157	3	5
β-strand	160-170	11	5
β-strand	183-192	10	5

Chain C: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5
β-strand	16-28	13	6
β-strand	36-48	13	6
α-helix	50-52	3
α-helix	56-59	4
β-strand	64-65	2	6
α-helix	68-70	3
β-strand	76-78	3	7
β-strand	81	1	6
β-strand	86-94	9	6
β-strand	99-111	13	6
β-strand	123-132	10	7
β-strand	140-144	5	6
α-helix	146-148	3
β-strand	150-151	2	6
β-strand	155-157	3	7
β-strand	160-168	9	7
β-strand	183-192	10	7

Chain D: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
β-strand	16-28	13	8
β-strand	36-48	13	8
α-helix	50-52	3
α-helix	56-59	4
β-strand	64-65	2	8
α-helix	68-70	3
β-strand	76-78	3	9
β-strand	81	1	8
β-strand	86-94	9	8
β-strand	99-111	13	8
β-strand	124-132	9	9
β-strand	140-144	5	8
α-helix	146-148	3
β-strand	150-151	2	8
β-strand	155-157	3	9
β-strand	160-169	10	9
β-strand	183-192	10	9

Chain E: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
β-strand	16-28	13	10
β-strand	36-48	13	10
α-helix	50-52	3
α-helix	56-59	4
β-strand	64-65	2	10
α-helix	68-70	3
β-strand	76-78	3	11
β-strand	81	1	10
β-strand	86-94	9	10
β-strand	99-111	13	10
β-strand	124-132	9	11
β-strand	140-144	5	10
α-helix	146-148	3
β-strand	150-151	2	10
β-strand	155-157	3	11
β-strand	160-171	12	11
β-strand	182-192	11	11

Chain F: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	16-28	13	12
β-strand	36-48	13	12
α-helix	50-52	3
α-helix	56-59	4
β-strand	64-65	2	12
α-helix	68-70	3
β-strand	76-78	3	13
β-strand	81	1	12
β-strand	86-94	9	12
β-strand	99-111	13	12
β-strand	123-132	10	13
β-strand	140-144	5	12
α-helix	146-148	3
β-strand	150-151	2	12
β-strand	155-157	3	13
β-strand	160-171	12	13
β-strand	182-192	11	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glr4197 protein	A, B, C, D, E, F	protein	201	Gloeobacter violaceus	Q7NDN8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>3IGQ_1 Glr4197 protein (chains A, B, C, D, E, F)
AQDMVSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSG
VRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDGRRTE
SDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRL
ESKLDYQLRISRQGGHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
HG	Mercury (II) ion	Hg	6

Water and common crystallization additives (CL, NA, ACY) are not listed.

Primary citation

Crystal structure of the extracellular domain of a bacterial ligand-gated ion channel. Nury, H., Bocquet, N., Le Poupon, C. et al. J Mol Biol (2010) 395:1114-1127. DOI 10.1016/j.jmb.2009.11.024 · PubMed

Other PDB entries of the same protein (UniProt Q7NDN8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9LBD 2.14 Å, Cryo-EM structure of nanodisc (PE:PS:PC) reconstituted GLIC F116A mutant at pH 2.5
6HZW 2.22 Å, THE GLIC PENTAMERIC LIGAND-GATED ION CHANNEL 2.22 resolution
6F0U 2.35 Å, GLIC mutant E35A
4HFI 2.4 Å, The GLIC pentameric Ligand-Gated Ion Channel at 2.4 A resolution
6F0R 2.5 Å, GLIC mutant E82Q
6F0Z 2.5 Å, GLIC mutant D88N
6HJZ 2.5 Å, Xray structure of GLIC in complex with succinate
6HZ1 2.5 Å, The glic pentameric ligand-gated ion channel mutant E243C
6HY5 2.58 Å, The glic pentameric ligand-gated ion channel mutant Q193C
3TLW 2.6 Å, The GLIC pentameric Ligand-Gated Ion Channel Loop2-21' oxidized mutant in a…
5IUX 2.6 Å, GLIC-V135C bimane labelled X-ray structure
6F16 2.6 Å, GLIC mutant H277Q

Browse structure collections

About this viewer

MolViewer shows 3IGQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.