3IJE: Integrin alpha-V

Crystal structure of the complete integrin alhaVbeta3 ectodomain plus an Alpha/beta transmembrane fragment. Determined by X-ray diffraction at 2.9 Å resolution. Released 29 Sept 2009.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 13,087
Mol. weight: 190.87 kDa
Ligands: NAG, CA
Released: 29 Sept 2009

Explore 3IJE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3IJE contains 44 α-helices and 134 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 84 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
β-strand	9-12	4	2
β-strand	22-26	5	3
β-strand	35-40	6	3
β-strand	55-60	6	3
β-strand	67-69	3	3
β-strand	79-81	3	4
β-strand	84-85	2	4
β-strand	87-88	2	5
β-strand	97-101	5	6
β-strand	104-109	6	6
β-strand	113-114	2	5
β-strand	123	1	5
β-strand	127-132	6	6
β-strand	135-139	5	6
β-strand	160-163	4	7
α-helix	164	1
β-strand	168-173	6	7
α-helix	176-179	4
β-strand	181	1	8
β-strand	182-187	6	7
α-helix	188-194	7
β-strand	208-209	2	7
α-helix	210-212	3
α-helix	215-217	3
β-strand	222	1	8
β-strand	225-229	5	9
β-strand	238-243	6	9
α-helix	246-249	4
β-strand	252-256	5	9
β-strand	263-268	6	9
β-strand	279-283	5	10
β-strand	292-297	6	10
β-strand	301-303	3	11
β-strand	309-311	3	11
β-strand	314-319	6	10
β-strand	327-332	6	10
β-strand	343-348	6	12
β-strand	357-362	6	12
β-strand	372-377	6	12
β-strand	378-379	2	13
β-strand	382-383	2	13
β-strand	389-392	4	12
α-helix	393	1
β-strand	404-412	9	2
β-strand	421-426	6	2
α-helix	427-429	3
β-strand	431-435	5	2
β-strand	437	1	1
α-helix	438-439	2
β-strand	440-441	2	14
β-strand	442-449	8	15
β-strand	453-454	2	16
β-strand	462	1	17
α-helix	463	1
β-strand	469	1	17
β-strand	471-482	12	15
β-strand	490-499	10	18
α-helix	501-504	4
β-strand	511-513	3	15
β-strand	520-528	9	18
β-strand	534-542	9	15
β-strand	555-563	9	18
β-strand	577-578	2	14
β-strand	585-590	6	18
β-strand	591-592	2	16
β-strand	606-611	6	19
β-strand	616-618	3	20
β-strand	623-633	11	19
α-helix	637	1
β-strand	638-639	2	21
β-strand	642-646	5	20
β-strand	651-656	6	19
β-strand	664	1	19
β-strand	667-671	5	20
β-strand	678-682	5	20
β-strand	686-687	2	21
β-strand	692-701	10	19
β-strand	710-718	9	20
β-strand	726	1	20
α-helix	727-729	3
β-strand	730-737	8	20
β-strand	742-748	7	22
β-strand	752-754	3	23
β-strand	775-784	10	22
β-strand	790	1	24
β-strand	792-802	11	23
β-strand	803	1	25
β-strand	806	1	25
β-strand	809-817	9	22
β-strand	820-824	5	23
β-strand	871-872	2	23
β-strand	878-886	9	23
β-strand	889	1	24
α-helix	890	1
β-strand	893-903	11	22
α-helix	905-908	4
β-strand	918-930	13	23
β-strand	941-952	12	23
α-helix	957-959	3

Chain B: 28 helices, 50 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	13-19	7
α-helix	42-46	5
α-helix	57-59	3
β-strand	60-65	6	26
α-helix	67-70	4
β-strand	72	1	27
α-helix	79-80	2
β-strand	83	1	28
β-strand	87-92	6	26
β-strand	97-105	9	28
β-strand	108	1	27
β-strand	112-119	8	29
β-strand	121	1	30
α-helix	122-124	3
α-helix	125-131	7
α-helix	136-145	10
β-strand	149-156	8	29
α-helix	172-174	3
α-helix	185-187	3
β-strand	190-197	8	29
α-helix	201-209	9
β-strand	213	1	30
β-strand	220	1	31
α-helix	222-231	10
α-helix	233-236	4
β-strand	243-250	8	29
β-strand	254	1	31
α-helix	259-261	3
α-helix	268-269	2
β-strand	275	1	32
β-strand	280	1	29
β-strand	281	1	32
α-helix	288-291	4
α-helix	292-301	10
β-strand	304-311	8	29
α-helix	312-314	3
α-helix	315-324	10
β-strand	329-333	5	29
α-helix	334	1
α-helix	340-351	12
β-strand	355-356	2	33
β-strand	357-360	4	26
β-strand	366-375	10	28
β-strand	378-381	4	28
β-strand	385-386	2	33
β-strand	394-403	10	28
β-strand	412-418	7	26
β-strand	425-431	7	26
β-strand	454-456	3	34
β-strand	459-461	3	34
β-strand	500-502	3	35
β-strand	505-507	3	35
β-strand	516-517	2	36
β-strand	523-524	2	36
β-strand	532	1	37
β-strand	534	1	37
β-strand	540-542	3	38
β-strand	547-549	3	38
α-helix	550	1
β-strand	553-554	2	39
β-strand	560-561	2	39
β-strand	568	1	40
β-strand	574	1	40
α-helix	575-577	3
β-strand	579-581	3	41
β-strand	586-588	3	41
β-strand	594	1	42
β-strand	600	1	42
α-helix	605-606	2
α-helix	607-620	14
α-helix	624-628	5
α-helix	631-634	4
β-strand	638-640	3	43
β-strand	654-658	5	43
β-strand	664-670	7	43
β-strand	678-681	4	43
β-strand	686	1	43

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-V	A	protein	967	Homo sapiens	P06756 (AlphaFold model)
Integrin beta-3	B	protein	695	Homo sapiens	P05106 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3IJE_1 Integrin alpha-V (chains A)
FNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCD
WSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQ
EREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQ
GQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFV
SGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLF
MDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAI
AAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYP
DLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLK
ADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIA
YLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDN
VCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNN
EALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSS
NLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIY
ELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQT
TEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVK
SLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPM
PVPVWVI

Sequence of entity 2 (B), FASTA

>3IJE_2 Integrin beta-3 (chains B)
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSE
ARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDL
SYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDM
KTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRN
DASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLS
QKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVR
DLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVG
FKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRP
SQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHG
QCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEK
CPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNE
DDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILV

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5
CA	Calcium ion	Ca	6

Primary citation

Crystal structure of the complete integrin alphaVbeta3 ectodomain plus an alpha/beta transmembrane fragment. Xiong, J.P., Mahalingham, B., Alonso, J.L. et al. J Cell Biol (2009) 186:589-600. DOI 10.1083/jcb.200905085 · PubMed

Other PDB entries of the same protein (UniProt P06756 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CZD 2.23 Å, Crystal structure of integrin avb6 headpiece in complex with compound 30
5FFG 2.25 Å, Crystal structure of integrin alpha V beta 6 head
8W30 2.45 Å, Crystal structure of alpha-V beta-1 integrin headpiece in complex with TR01225179
9CZA 2.49 Å, Crystal structure of integrin avb6 headpiece in complex with compound 18
4UM9 2.5 Å, Crystal structure of alpha V beta 6 with peptide
9CZF 2.53 Å, Crystal structure of integrin avb6 headpiece in complex with compound MORF-627
9CZ7 2.57 Å, Crystal structure of integrin avb6 headpiece in complex with compound 12
6OM1 2.66 Å, Crystal structure of an atypical integrin
8VS6 2.73 Å, L-TGF-b3/avb8
6OM2 2.77 Å, Crystal structure of atypical integrin alphaV beta8 with proTGF-beta1 ligand peptide
9IUJ 2.78 Å, Integrin alpha-v beta-3 in complex with rhodostomin
9LT3 2.79 Å, Integrin alpha-v beta-3 in complex with Trimucrin

Browse structure collections

About this viewer

MolViewer shows 3IJE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.