3IKO: Protein transport protein SEC13
Crystal structure of the heterotrimeric Sec13-Nup145C-Nup84 nucleoporin complex. Determined by X-ray diffraction at 3.2 Å resolution. Released 13 Oct 2009.
- Method
- X-ray diffraction
- Resolution
- 3.2 Å
- Organism
- Saccharomyces cerevisiae
- Chains
- 9
- Atoms
- 27,032
- Mol. weight
- 410.88 kDa
- Released
- 13 Oct 2009
Explore 3IKO in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3IKO contains 169 α-helices and 132 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A, D and G: 1 helix, 33 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 12-17 | 6 | 1 |
| β-strand | 23-28 | 6 | 1 |
| β-strand | 32-37 | 6 | 1 |
| β-strand | 44-45 | 2 | 1 |
| β-strand | 49-50 | 2 | 1 |
| β-strand | 56-58 | 3 | 2 |
| β-strand | 61 | 1 | 2 |
| α-helix | 64-66 | 3 | |
| β-strand | 69-74 | 6 | 2 |
| β-strand | 79-83 | 5 | 2 |
| β-strand | 84-85 | 2 | 3 |
| β-strand | 88-89 | 2 | 3 |
| β-strand | 93-95 | 3 | 2 |
| β-strand | 102-105 | 4 | 4 |
| β-strand | 118-120 | 3 | 4 |
| β-strand | 124-126 | 3 | 4 |
| β-strand | 129-130 | 2 | 5 |
| β-strand | 136-137 | 2 | 5 |
| β-strand | 141-142 | 2 | 4 |
| β-strand | 148-153 | 6 | 6 |
| β-strand | 172-177 | 6 | 6 |
| β-strand | 181-186 | 6 | 6 |
| β-strand | 195-201 | 7 | 6 |
| β-strand | 209 | 1 | 7 |
| β-strand | 212 | 1 | 8 |
| β-strand | 220 | 1 | 9 |
| β-strand | 222 | 1 | 8 |
| β-strand | 223-225 | 3 | 7 |
| β-strand | 231-233 | 3 | 7 |
| β-strand | 236 | 1 | 9 |
| β-strand | 257-262 | 6 | 10 |
| β-strand | 269-273 | 5 | 10 |
| β-strand | 278-283 | 6 | 10 |
| β-strand | 289-291 | 3 | 10 |
Chain B: 26 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 128-142 | 15 | |
| β-strand | 151-153 | 3 | 11 |
| β-strand | 159-161 | 3 | 11 |
| β-strand | 162-163 | 2 | 12 |
| β-strand | 169-170 | 2 | 12 |
| β-strand | 173 | 1 | 11 |
| α-helix | 182-185 | 4 | |
| α-helix | 187-195 | 9 | |
| β-strand | 197-199 | 3 | 13 |
| β-strand | 210-213 | 4 | 13 |
| α-helix | 219-221 | 3 | |
| α-helix | 229-241 | 13 | |
| α-helix | 243-244 | 2 | |
| α-helix | 249-250 | 2 | |
| α-helix | 253-286 | 34 | |
| α-helix | 290-299 | 10 | |
| α-helix | 303-312 | 10 | |
| α-helix | 316-322 | 7 | |
| α-helix | 330-343 | 14 | |
| α-helix | 352-361 | 10 | |
| α-helix | 372-377 | 6 | |
| α-helix | 381-390 | 10 | |
| α-helix | 399-407 | 9 | |
| α-helix | 417-426 | 10 | |
| α-helix | 428-430 | 3 | |
| α-helix | 431-439 | 9 | |
| α-helix | 447-458 | 12 | |
| α-helix | 467-482 | 16 | |
| α-helix | 487-495 | 9 | |
| α-helix | 500-512 | 13 | |
| α-helix | 517-519 | 3 | |
| α-helix | 522-528 | 7 | |
| α-helix | 534-543 | 10 | |
Chain C: 30 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-10 | 3 | |
| α-helix | 12-23 | 12 | |
| α-helix | 36-55 | 20 | |
| α-helix | 61-87 | 27 | |
| α-helix | 102-112 | 11 | |
| α-helix | 114-128 | 15 | |
| α-helix | 134-136 | 3 | |
| α-helix | 145-149 | 5 | |
| α-helix | 160-163 | 4 | |
| α-helix | 166-168 | 3 | |
| α-helix | 171-189 | 19 | |
| α-helix | 193-202 | 10 | |
| α-helix | 206-213 | 8 | |
| β-strand | 217 | 1 | 14 |
| α-helix | 218 | 1 | |
| β-strand | 219 | 1 | 15 |
| α-helix | 225-227 | 3 | |
| β-strand | 235 | 1 | 15 |
| β-strand | 237 | 1 | 14 |
| α-helix | 240-252 | 13 | |
| α-helix | 258-268 | 11 | |
| α-helix | 271-273 | 3 | |
| α-helix | 274-277 | 4 | |
| α-helix | 282-304 | 23 | |
| α-helix | 310-312 | 3 | |
| α-helix | 324-334 | 11 | |
| α-helix | 336-340 | 5 | |
| α-helix | 344-351 | 8 | |
| α-helix | 356-364 | 9 | |
| α-helix | 383-399 | 17 | |
| α-helix | 406-422 | 17 | |
| α-helix | 426-428 | 3 | |
| α-helix | 429-433 | 5 | |
| α-helix | 437-441 | 5 | |
Chain E: 26 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 133-140 | 8 | |
| β-strand | 151-153 | 3 | 26 |
| β-strand | 159-161 | 3 | 26 |
| β-strand | 162-163 | 2 | 27 |
| β-strand | 169-170 | 2 | 27 |
| β-strand | 173 | 1 | 26 |
| α-helix | 182-185 | 4 | |
| α-helix | 187-195 | 9 | |
| β-strand | 197-199 | 3 | 28 |
| β-strand | 210-213 | 4 | 28 |
| α-helix | 219-221 | 3 | |
| α-helix | 229-241 | 13 | |
| α-helix | 243-244 | 2 | |
| α-helix | 249-250 | 2 | |
| α-helix | 253-286 | 34 | |
| α-helix | 290-299 | 10 | |
| α-helix | 303-312 | 10 | |
| α-helix | 316-322 | 7 | |
| α-helix | 330-343 | 14 | |
| α-helix | 352-361 | 10 | |
| α-helix | 373-377 | 5 | |
| α-helix | 381-390 | 10 | |
| α-helix | 399-407 | 9 | |
| α-helix | 417-426 | 10 | |
| α-helix | 428-430 | 3 | |
| α-helix | 431-439 | 9 | |
| α-helix | 447-458 | 12 | |
| α-helix | 467-482 | 16 | |
| α-helix | 487-495 | 9 | |
| α-helix | 500-512 | 13 | |
| α-helix | 517-519 | 3 | |
| α-helix | 522-528 | 7 | |
| α-helix | 534-543 | 10 | |
Chain F: 29 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-23 | 12 | |
| α-helix | 36-55 | 20 | |
| α-helix | 59-86 | 28 | |
| α-helix | 102-112 | 11 | |
| α-helix | 114-128 | 15 | |
| α-helix | 134-136 | 3 | |
| α-helix | 145-149 | 5 | |
| α-helix | 160-163 | 4 | |
| α-helix | 166-168 | 3 | |
| α-helix | 171-189 | 19 | |
| α-helix | 193-202 | 10 | |
| α-helix | 206-213 | 8 | |
| β-strand | 217 | 1 | 29 |
| α-helix | 218 | 1 | |
| β-strand | 219 | 1 | 30 |
| α-helix | 225-227 | 3 | |
| β-strand | 235 | 1 | 30 |
| β-strand | 237 | 1 | 29 |
| α-helix | 240-252 | 13 | |
| α-helix | 258-268 | 11 | |
| α-helix | 271-273 | 3 | |
| α-helix | 274-277 | 4 | |
| α-helix | 282-304 | 23 | |
| α-helix | 310-312 | 3 | |
| α-helix | 324-334 | 11 | |
| α-helix | 336-340 | 5 | |
| α-helix | 344-351 | 8 | |
| α-helix | 356-364 | 9 | |
| α-helix | 383-399 | 17 | |
| α-helix | 406-423 | 18 | |
| α-helix | 426-428 | 3 | |
| α-helix | 429-433 | 5 | |
| α-helix | 436-441 | 6 | |
Chain H: 26 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 133-136 | 4 | |
| β-strand | 151-153 | 3 | 41 |
| β-strand | 159-161 | 3 | 41 |
| β-strand | 162-163 | 2 | 42 |
| β-strand | 169-170 | 2 | 42 |
| β-strand | 173 | 1 | 41 |
| α-helix | 182-185 | 4 | |
| α-helix | 187-195 | 9 | |
| β-strand | 197-199 | 3 | 43 |
| β-strand | 210-213 | 4 | 43 |
| α-helix | 219-221 | 3 | |
| α-helix | 229-241 | 13 | |
| α-helix | 243-244 | 2 | |
| α-helix | 249-250 | 2 | |
| α-helix | 253-286 | 34 | |
| α-helix | 290-299 | 10 | |
| α-helix | 303-312 | 10 | |
| α-helix | 316-322 | 7 | |
| α-helix | 330-343 | 14 | |
| α-helix | 352-361 | 10 | |
| α-helix | 372-377 | 6 | |
| α-helix | 381-390 | 10 | |
| α-helix | 399-407 | 9 | |
| α-helix | 417-426 | 10 | |
| α-helix | 428-430 | 3 | |
| α-helix | 431-439 | 9 | |
| α-helix | 447-458 | 12 | |
| α-helix | 467-482 | 16 | |
| α-helix | 487-495 | 9 | |
| α-helix | 500-512 | 13 | |
| α-helix | 517-519 | 3 | |
| α-helix | 522-528 | 7 | |
| α-helix | 534-543 | 10 | |
Chain I: 29 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-23 | 13 | |
| α-helix | 25-28 | 4 | |
| α-helix | 36-55 | 20 | |
| α-helix | 61-85 | 25 | |
| α-helix | 102-112 | 11 | |
| α-helix | 114-128 | 15 | |
| α-helix | 134-136 | 3 | |
| α-helix | 145-149 | 5 | |
| α-helix | 160-163 | 4 | |
| α-helix | 166-168 | 3 | |
| α-helix | 171-189 | 19 | |
| α-helix | 193-202 | 10 | |
| α-helix | 206-213 | 8 | |
| β-strand | 217 | 1 | 44 |
| α-helix | 218 | 1 | |
| β-strand | 219 | 1 | 45 |
| α-helix | 225-227 | 3 | |
| β-strand | 235 | 1 | 45 |
| β-strand | 237 | 1 | 44 |
| α-helix | 240-252 | 13 | |
| α-helix | 258-268 | 11 | |
| α-helix | 271-273 | 3 | |
| α-helix | 274-277 | 4 | |
| α-helix | 282-304 | 23 | |
| α-helix | 310-312 | 3 | |
| α-helix | 324-334 | 11 | |
| α-helix | 336-340 | 5 | |
| α-helix | 344-352 | 9 | |
| α-helix | 356-365 | 10 | |
| α-helix | 383-399 | 17 | |
| α-helix | 406-421 | 16 | |
| α-helix | 426-428 | 3 | |
| α-helix | 429-433 | 5 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Protein transport protein SEC13 | A, D, G | protein | 297 | Saccharomyces cerevisiae | Q04491 (AlphaFold model) |
| Nucleoporin NUP145C | B, E, H | protein | 442 | Saccharomyces cerevisiae | P49687 (AlphaFold model) |
| Nucleoporin NUP84 | C, F, I | protein | 460 | Saccharomyces cerevisiae | P52891 (AlphaFold model) |
Sequence of entity 1 (A, D, G), FASTA
>3IKO_1 Protein transport protein SEC13 (chains A, D, G)
MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
WAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVAS
SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ
GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Sequence of entity 2 (B, E, H), FASTA
>3IKO_2 Nucleoporin NUP145C (chains B, E, H)
MGSSHHHHHHSQDPFSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGV
SIKRLPTELQRKFLFDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSD
YNLWKLSSILFDPVSYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNE
IEQIFLYLLLNDVVRASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSI
DKNISKIYKLLSGSPFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKF
SLPYDDPIGVIFQLYAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETS
DEATFAFAAQLEFAQLHGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRL
KIPSQLIFNAQALKDRYEGNYL
Sequence of entity 3 (C, F, I), FASTA
>3IKO_3 Nucleoporin NUP84 (chains C, F, I)
MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDES
NVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIW
IVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIF
FKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKH
SLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIEN
YLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIH
SSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLL
KLQGLYENIPIYATFLNESDCLEACSFILSSLEDPQVRKK
Primary citation
Structure of a trimeric nucleoporin complex reveals alternate oligomerization states. Nagy, V., Hsia, K.C., Debler, E.W. et al. Proc Natl Acad Sci U S A (2009) 106:17693-17698. DOI 10.1073/pnas.0909373106 · PubMed
Other PDB entries of the same protein (UniProt Q04491 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2PM7 2.35 Å, Crystal structure of yeast Sec13/31 edge element of the COPII vesicular coat,…
- 2PM6 2.45 Å, Crystal Structure of yeast Sec13/31 edge element of the COPII vesicular coat, native…
- 3JRP 2.6 Å, SEC13 with NUP145C (AA109-179) insertion blade
- 3MZK 2.69 Å, Sec13/Sec16 complex, S.cerevisiae
- 3MZL 2.8 Å, Sec13/Sec31 edge element, loop deletion mutant
- 8ADL 2.95 Å, Cryo-EM structure of the SEA complex
- 9H5K 3.2 Å, Cryo-EM structure of the SEAC-EGOC supercomplex
- 2PM9 3.3 Å, Crystal structure of yeast Sec13/31 vertex element of the COPII vesicular coat
- 3JRO 4.0 Å, NUP84-NUP145C-SEC13 edge element of the NPC lattice
- 4XMM 7.38 Å, Structure of the yeast coat nucleoporin complex, space group C2
- 4XMN 7.6 Å, Structure of the yeast coat nucleoporin complex, space group P212121
- 8TIE 8.1 Å, Double nuclear outer ring of Nup84-complexes from the yeast NPC
Browse structure collections
About this viewer
MolViewer shows 3IKO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.