Crystal structure of interleukin 8: symbiosis of NMR and crystallography. Determined by X-ray diffraction at 2.0 Å resolution. Released 15 Oct 1992.
Explore 3IL8 in 3D Show helices and sheets RCSB PDB PDBe
3IL8 contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 19-21 | 3 | |
| β-strand | 22-28 | 7 | 1 |
| β-strand | 31 | 1 | 2 |
| β-strand | 34 | 1 | 2 |
| β-strand | 38-43 | 6 | 1 |
| β-strand | 48-51 | 4 | 1 |
| α-helix | 56-70 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-8 | A | protein | 72 | Homo sapiens | P10145 (AlphaFold model) |
>3IL8_1 INTERLEUKIN-8 (chains A) SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQR VVEKFLKRAENS
Crystal structure of interleukin 8: symbiosis of NMR and crystallography. Baldwin, E.T., Weber, I.T., St Charles, R. et al. Proc Natl Acad Sci U S A (1991) 88:502-506. DOI 10.1073/pnas.88.2.502 · PubMed
Other PDB entries of the same protein (UniProt P10145 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3IL8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.