9YIP: Human IL-8 in a large unit cell

Crystal structure of human IL-8 in a large unit cell. Determined by X-ray diffraction at 2.2 Å resolution. Released 30 Sept 2026.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 6
Atoms: 3,580
Mol. weight: 55.38 kDa
Released: 30 Sept 2026

Explore 9YIP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9YIP contains 14 α-helices and 26 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and F: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	19-21	3
β-strand	22-28	7	1
β-strand	38-43	6	1
β-strand	48-51	4	1
α-helix	56-69	14

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
α-helix	19-21	3
β-strand	22-28	7	1
β-strand	31	1	2
β-strand	34	1	2
β-strand	38-43	6	1
β-strand	48-51	4	1
α-helix	56-70	15
β-strand	73	1	3

Chain C: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
β-strand	7	1	3
α-helix	19-21	3
β-strand	22-28	7	4
β-strand	31	1	5
β-strand	34	1	5
β-strand	38-43	6	4
β-strand	48-51	4	4
α-helix	56-71	16

Chain D: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	19-21	3
β-strand	22-28	7	4
β-strand	31	1	6
β-strand	34	1	6
β-strand	38-43	6	4
β-strand	48-51	4	4
α-helix	56-70	15

Chain E: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	19-21	3
β-strand	22-28	7	7
β-strand	38-43	6	7
β-strand	48-51	4	7
α-helix	56-70	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IL-8(6-77)	A, B, C, D, E, F	protein	78	Homo sapiens	P10145 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>9YIP_1 IL-8(6-77) (chains A, B, C, D, E, F)
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQR
VVEKFLKRAENSHHHHHH

Primary citation

Crystal structure of human IL-8 in a large unit cell. Lodowski, D.T., Chapman, P.Q. To be published.

Other PDB entries of the same protein (UniProt P10145 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4XDX 0.95 Å, The crystal structure of soluble human interleukin 8 expressed in Pichia pastoris
5D14 1.0 Å, The atomic resolution crystal structure of human IL-8
6N2U 1.25 Å, IL-8 Structure from Bacterial Expression Source
3IL8 2.0 Å, Crystal structure of interleukin 8: symbiosis of NMR and crystallography
1ICW 2.01 Å, Interleukin-8, mutant with glu 38 replaced by cys and cys 50 replaced by ala
6WZM 2.28 Å, LY3041658 Fab bound to CXCL8
1QE6 2.35 Å, Interleukin-8 with an added disulfide between residues 5 and 33 (L5C/H33C)
8XX6 2.99 Å, Structure of CXCR2 bound to CXCL8 (CXCR2-CXCL8-Go Full map)
8XWN 3.29 Å, Structure of CXCR2 bound to CXCL8 (Ligand-receptor focused map)
6LFO 3.4 Å, Cryo-EM structure of a class A GPCR monomer
8IC0 3.41 Å, Cryo-EM structure of CXCL8 bound C-X-C chemokine receptor 1 in complex with Gi…
6LFM 3.5 Å, Cryo-EM structure of a class A GPCR

Browse structure collections

About this viewer

MolViewer shows 9YIP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.