3JSS: Mutant RelB dimerization domain

Crystal structure of a mutant RelB dimerization domain. Determined by X-ray diffraction at 2.6 Å resolution. Released 24 Nov 2010.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Mus musculus
Chains: 1
Atoms: 803
Mol. weight: 11.46 kDa
Released: 24 Nov 2010

Explore 3JSS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JSS contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	283-286	4	1
β-strand	301-303	3	1
β-strand	314-317	4	2
β-strand	320-323	4	2
α-helix	328-330	3
α-helix	340-344	5
β-strand	353-357	5	3
β-strand	360	1	4
β-strand	367	1	4
β-strand	371-375	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor RelB	A	protein	101	Mus musculus	Q04863 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3JSS_1 Transcription factor RelB (chains A)
TSELRICRINKESGPCTGGEELYLLCDKVQKEDISVRFSTASWEGRGDFSQADVHRQIAI
VFKTPPYEDLEISEPVTVNVQLQRLTDGECSEPLPFTYLPR

Primary citation

A structural basis for selective dimerization by NF-kappa B RelB. Vu, D., Huang, D.B., Vemu, A. et al. J Mol Biol (2013) 425:1934-1945. DOI 10.1016/j.jmb.2013.02.020 · PubMed

Other PDB entries of the same protein (UniProt Q04863 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ZK9 2.18 Å, NF-kB RelB forms an intertwined homodimer
1ZKA 2.2 Å, NF-kB RelB forms an intertwined homodimer, Y300S mutant
4JHB 2.44 Å, Crystal structure of RelB double mutants: Y300F/I335F
3JUZ 2.51 Å, Crystal structure of a mutant of RelB dimerization domain(M5)
3JV0 2.65 Å, Crystal structure of a mutant of RelB dimerization domain(M6)
3JV6 2.78 Å, Crystal structure of the dimerization domains p52 and RelB
4JGM 3.0 Å, Crystal structure of RelB double mutants: Y300F/I335V
2V2T 3.05 Å, X-ray structure of a NF-kB p50-RelB-DNA complex
3DO7 3.05 Å, X-ray structure of a NF-kB p52/RelB/DNA complex
3JV4 3.15 Å, Crystal structure of the dimerization domains p50 and RelB

Browse structure collections

About this viewer

MolViewer shows 3JSS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.