3K7A: RNA polymerase II-TFIIB complex
Crystal Structure of an RNA polymerase II-TFIIB complex. Determined by X-ray diffraction at 3.8 Å resolution. Released 24 Nov 2009.
- Method
- X-ray diffraction
- Resolution
- 3.8 Å
- Organism
- Saccharomyces cerevisiae
- Chains
- 11
- Atoms
- 29,029
- Mol. weight
- 508.47 kDa
- Ligands
- ZN
- Released
- 24 Nov 2009
Explore 3K7A in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3K7A contains 177 α-helices and 195 β-strands across 11 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 72 helices, 68 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10 | 1 | |
| β-strand | 11-12 | 2 | 1 |
| β-strand | 16-21 | 6 | 2 |
| α-helix | 24-30 | 7 | |
| β-strand | 43 | 1 | 3 |
| β-strand | 46 | 1 | 3 |
| β-strand | 82 | 1 | 4 |
| β-strand | 85-91 | 7 | 5 |
| α-helix | 96-103 | 8 | |
| β-strand | 106 | 1 | 6 |
| β-strand | 113 | 1 | 6 |
| α-helix | 120-127 | 8 | |
| α-helix | 131-142 | 12 | |
| β-strand | 147 | 1 | 7 |
| β-strand | 151-152 | 2 | 8 |
| β-strand | 162-163 | 2 | 8 |
| α-helix | 169 | 1 | |
| β-strand | 170 | 1 | 7 |
| α-helix | 171-172 | 2 | |
| β-strand | 175-177 | 3 | 9 |
| β-strand | 180-183 | 4 | 9 |
| α-helix | 188-190 | 3 | |
| β-strand | 200-202 | 3 | 9 |
| α-helix | 204-212 | 9 | |
| α-helix | 216-221 | 6 | |
| α-helix | 231-233 | 3 | |
| β-strand | 235-238 | 4 | 5 |
| α-helix | 240 | 1 | |
| β-strand | 241 | 1 | 4 |
| α-helix | 242 | 1 | |
| α-helix | 261-281 | 21 | |
| α-helix | 290-302 | 13 | |
| α-helix | 326-329 | 4 | |
| α-helix | 335 | 1 | |
| α-helix | 336-340 | 5 | |
| β-strand | 343-345 | 3 | 10 |
| β-strand | 348-355 | 8 | 11 |
| β-strand | 363-367 | 5 | 11 |
| α-helix | 368-373 | 6 | |
| β-strand | 375-379 | 5 | 12 |
| α-helix | 380 | 1 | |
| α-helix | 385-394 | 10 | |
| β-strand | 402 | 1 | 12 |
| β-strand | 406 | 1 | 12 |
| β-strand | 412 | 1 | 12 |
| β-strand | 431-435 | 5 | 12 |
| β-strand | 441-445 | 5 | 11 |
| β-strand | 455-463 | 9 | 11 |
| β-strand | 468-470 | 3 | 11 |
| α-helix | 472-474 | 3 | |
| β-strand | 486-490 | 5 | 11 |
| α-helix | 495-503 | 9 | |
| β-strand | 506 | 1 | 11 |
| α-helix | 508-510 | 3 | |
| β-strand | 512-513 | 2 | 13 |
| α-helix | 514-516 | 3 | |
| β-strand | 518-519 | 2 | 13 |
| α-helix | 525-535 | 11 | |
| β-strand | 540-542 | 3 | 14 |
| α-helix | 543-552 | 10 | |
| α-helix | 560-563 | 4 | |
| β-strand | 565 | 1 | 14 |
| β-strand | 571-573 | 3 | 14 |
| α-helix | 574-581 | 8 | |
| α-helix | 583 | 1 | |
| β-strand | 588-589 | 2 | 15 |
| β-strand | 606-607 | 2 | 15 |
| β-strand | 612-614 | 3 | 15 |
| α-helix | 619-622 | 4 | |
| α-helix | 629-636 | 8 | |
| α-helix | 639-660 | 22 | |
| β-strand | 663 | 1 | 16 |
| α-helix | 666-669 | 4 | |
| α-helix | 670-672 | 3 | |
| α-helix | 673-698 | 26 | |
| α-helix | 704-705 | 2 | |
| α-helix | 710-735 | 26 | |
| α-helix | 742-749 | 8 | |
| α-helix | 755-762 | 8 | |
| β-strand | 766-767 | 2 | 17 |
| β-strand | 769-770 | 2 | 18 |
| β-strand | 773-774 | 2 | 18 |
| α-helix | 794-796 | 3 | |
| β-strand | 799-800 | 2 | 17 |
| α-helix | 810-845 | 36 | |
| β-strand | 849-850 | 2 | 19 |
| β-strand | 856-857 | 2 | 19 |
| β-strand | 863-865 | 3 | 19 |
| α-helix | 868-870 | 3 | |
| β-strand | 873 | 1 | 20 |
| α-helix | 875-877 | 3 | |
| β-strand | 878-882 | 5 | 21 |
| α-helix | 890-897 | 8 | |
| α-helix | 908-909 | 2 | |
| β-strand | 913 | 1 | 22 |
| α-helix | 923-946 | 24 | |
| β-strand | 953-957 | 5 | 21 |
| α-helix | 960-968 | 9 | |
| β-strand | 979 | 1 | 22 |
| α-helix | 983-993 | 11 | |
| α-helix | 1005-1025 | 21 | |
| α-helix | 1028-1029 | 2 | |
| α-helix | 1030-1034 | 5 | |
| α-helix | 1039-1055 | 17 | |
| β-strand | 1057 | 1 | 20 |
| α-helix | 1058-1059 | 2 | |
| α-helix | 1064-1077 | 14 | |
| α-helix | 1098-1105 | 8 | |
| β-strand | 1116-1120 | 5 | 23 |
| α-helix | 1128-1138 | 11 | |
| β-strand | 1141-1142 | 2 | 24 |
| α-helix | 1143-1146 | 4 | |
| β-strand | 1147-1151 | 5 | 25 |
| β-strand | 1154 | 1 | 26 |
| α-helix | 1167-1171 | 5 | |
| β-strand | 1191 | 1 | 26 |
| β-strand | 1193-1197 | 5 | 25 |
| α-helix | 1199-1204 | 6 | |
| α-helix | 1209-1220 | 12 | |
| β-strand | 1224-1228 | 5 | 25 |
| β-strand | 1237-1242 | 6 | 25 |
| α-helix | 1259-1265 | 7 | |
| α-helix | 1266-1270 | 5 | |
| β-strand | 1272-1274 | 3 | 24 |
| β-strand | 1282-1287 | 6 | 23 |
| β-strand | 1290-1292 | 3 | 27 |
| β-strand | 1298-1300 | 3 | 27 |
| β-strand | 1303-1308 | 6 | 23 |
| α-helix | 1313-1316 | 4 | |
| β-strand | 1322-1329 | 8 | 23 |
| α-helix | 1332-1339 | 8 | |
| α-helix | 1341-1357 | 17 | |
| α-helix | 1365-1376 | 12 | |
| α-helix | 1396-1400 | 5 | |
| α-helix | 1405-1414 | 10 | |
| α-helix | 1417 | 1 | |
| β-strand | 1418-1419 | 2 | 2 |
| α-helix | 1424-1429 | 6 | |
| α-helix | 1437-1439 | 3 | |
| β-strand | 1441-1444 | 4 | 28 |
Chain B: 55 helices, 68 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 30-41 | 12 | |
| α-helix | 45-53 | 9 | |
| α-helix | 54-58 | 5 | |
| α-helix | 59-63 | 5 | |
| β-strand | 91-97 | 7 | 29 |
| β-strand | 101-102 | 2 | 30 |
| β-strand | 110-111 | 2 | 30 |
| α-helix | 114-119 | 6 | |
| β-strand | 125-133 | 9 | 29 |
| β-strand | 165-171 | 7 | 29 |
| α-helix | 172-173 | 2 | |
| α-helix | 180-182 | 3 | |
| α-helix | 186-191 | 6 | |
| β-strand | 203-205 | 3 | 31 |
| β-strand | 208-211 | 4 | 31 |
| α-helix | 213 | 1 | |
| β-strand | 214-218 | 5 | 32 |
| α-helix | 219 | 1 | |
| β-strand | 223-227 | 5 | 33 |
| β-strand | 234-240 | 7 | 33 |
| β-strand | 254-259 | 6 | 33 |
| β-strand | 268-272 | 5 | 33 |
| β-strand | 279-281 | 3 | 33 |
| α-helix | 282-288 | 7 | |
| α-helix | 296-301 | 6 | |
| α-helix | 308-321 | 14 | |
| α-helix | 327-332 | 6 | |
| α-helix | 344-354 | 11 | |
| α-helix | 355-359 | 5 | |
| α-helix | 371-389 | 19 | |
| α-helix | 394-396 | 3 | |
| α-helix | 401-403 | 3 | |
| β-strand | 404-407 | 4 | 32 |
| α-helix | 409-432 | 24 | |
| α-helix | 449-462 | 14 | |
| α-helix | 474-476 | 3 | |
| β-strand | 481-482 | 2 | 31 |
| α-helix | 483-484 | 2 | |
| α-helix | 488-495 | 8 | |
| β-strand | 497-499 | 3 | 32 |
| α-helix | 514-515 | 2 | |
| α-helix | 516-518 | 3 | |
| β-strand | 522 | 1 | 34 |
| β-strand | 536-538 | 3 | 32 |
| β-strand | 539 | 1 | 34 |
| β-strand | 540 | 1 | 35 |
| β-strand | 544-545 | 2 | 36 |
| α-helix | 552-559 | 8 | |
| β-strand | 564-565 | 2 | 37 |
| α-helix | 566-568 | 3 | |
| α-helix | 577 | 1 | |
| β-strand | 578-582 | 5 | 37 |
| β-strand | 585-590 | 6 | 37 |
| α-helix | 593-606 | 14 | |
| β-strand | 614-618 | 5 | 37 |
| α-helix | 619-621 | 3 | |
| β-strand | 623-627 | 5 | 37 |
| β-strand | 633-639 | 7 | 36 |
| α-helix | 655-666 | 12 | |
| α-helix | 682-686 | 5 | |
| β-strand | 690-694 | 5 | 36 |
| α-helix | 697-700 | 4 | |
| β-strand | 703-704 | 2 | 36 |
| α-helix | 713-714 | 2 | |
| α-helix | 728-729 | 2 | |
| β-strand | 740-741 | 2 | 36 |
| α-helix | 745-748 | 4 | |
| β-strand | 750 | 1 | 35 |
| α-helix | 753-755 | 3 | |
| α-helix | 764-773 | 10 | |
| β-strand | 793-796 | 4 | 38 |
| β-strand | 800 | 1 | 39 |
| β-strand | 804-805 | 2 | 40 |
| α-helix | 807-810 | 4 | |
| β-strand | 821-827 | 7 | 41 |
| β-strand | 828 | 1 | 16 |
| α-helix | 835-837 | 3 | |
| β-strand | 838-842 | 5 | 41 |
| α-helix | 843-848 | 6 | |
| β-strand | 853-861 | 9 | 38 |
| β-strand | 873-874 | 2 | 42 |
| β-strand | 893 | 1 | 43 |
| β-strand | 898 | 1 | 44 |
| β-strand | 899 | 1 | 43 |
| β-strand | 904-905 | 2 | 38 |
| β-strand | 910 | 1 | 45 |
| β-strand | 912 | 1 | 44 |
| β-strand | 914-915 | 2 | 42 |
| β-strand | 936 | 1 | 42 |
| β-strand | 940 | 1 | 45 |
| α-helix | 941-942 | 2 | |
| β-strand | 947-957 | 11 | 38 |
| β-strand | 961-972 | 12 | 38 |
| β-strand | 979-981 | 3 | 41 |
| β-strand | 987-994 | 8 | 41 |
| β-strand | 1001-1002 | 2 | 46 |
| β-strand | 1010-1012 | 3 | 41 |
| α-helix | 1024-1038 | 15 | |
| β-strand | 1042-1043 | 2 | 40 |
| α-helix | 1052-1061 | 10 | |
| β-strand | 1069-1070 | 2 | 41 |
| β-strand | 1072-1073 | 2 | 46 |
| α-helix | 1079 | 1 | |
| β-strand | 1080 | 1 | 46 |
| α-helix | 1081 | 1 | |
| β-strand | 1085-1094 | 10 | 41 |
| α-helix | 1099-1101 | 3 | |
| β-strand | 1105 | 1 | 11 |
| α-helix | 1110 | 1 | |
| β-strand | 1111 | 1 | 47 |
| α-helix | 1112 | 1 | |
| β-strand | 1118 | 1 | 47 |
| α-helix | 1127 | 1 | |
| β-strand | 1128-1130 | 3 | 10 |
| α-helix | 1132-1141 | 10 | |
| α-helix | 1144-1148 | 5 | |
| α-helix | 1149-1153 | 5 | |
| β-strand | 1158-1163 | 6 | 1 |
| β-strand | 1174 | 1 | 48 |
| β-strand | 1179 | 1 | 48 |
| β-strand | 1191-1196 | 6 | 1 |
| α-helix | 1198-1209 | 12 | |
| β-strand | 1212-1217 | 6 | 2 |
Chain C: 11 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7-13 | 7 | 49 |
| β-strand | 18-23 | 6 | 49 |
| α-helix | 27-39 | 13 | |
| β-strand | 43-54 | 12 | 50 |
| α-helix | 60-69 | 10 | |
| β-strand | 72 | 1 | 51 |
| α-helix | 75-79 | 5 | |
| β-strand | 97-104 | 8 | 50 |
| β-strand | 111-114 | 4 | 52 |
| α-helix | 115-117 | 3 | |
| β-strand | 119-120 | 2 | 50 |
| α-helix | 131 | 1 | |
| β-strand | 132 | 1 | 51 |
| α-helix | 133 | 1 | |
| β-strand | 143-147 | 5 | 52 |
| β-strand | 152-162 | 11 | 50 |
| α-helix | 168-170 | 3 | |
| β-strand | 176-179 | 4 | 49 |
| α-helix | 197-200 | 4 | |
| α-helix | 205-209 | 5 | |
| α-helix | 217-219 | 3 | |
| β-strand | 228-232 | 5 | 49 |
| α-helix | 240-263 | 24 | |
Chain E: 15 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-5 | 3 | |
| α-helix | 7-25 | 19 | |
| β-strand | 28 | 1 | 53 |
| α-helix | 32-35 | 4 | |
| α-helix | 39-46 | 8 | |
| β-strand | 47 | 1 | 54 |
| β-strand | 53 | 1 | 54 |
| α-helix | 55-57 | 3 | |
| β-strand | 60-62 | 3 | 55 |
| β-strand | 64 | 1 | 53 |
| α-helix | 68-71 | 4 | |
| β-strand | 78-82 | 5 | 55 |
| β-strand | 87-88 | 2 | 56 |
| α-helix | 90-103 | 14 | |
| β-strand | 107-112 | 6 | 55 |
| β-strand | 115-116 | 2 | 56 |
| α-helix | 121-123 | 3 | |
| β-strand | 131-136 | 6 | 55 |
| α-helix | 138-141 | 4 | |
| α-helix | 144-146 | 3 | |
| β-strand | 152-155 | 4 | 57 |
| α-helix | 156-157 | 2 | |
| α-helix | 160-166 | 7 | |
| α-helix | 172-174 | 3 | |
| α-helix | 176 | 1 | |
| β-strand | 177-178 | 2 | 57 |
| α-helix | 183-187 | 5 | |
| β-strand | 195-201 | 7 | 57 |
| β-strand | 207-214 | 8 | 57 |
Chain F: 4 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 84 | 1 | 58 |
| α-helix | 85-86 | 2 | |
| α-helix | 87-101 | 15 | |
| α-helix | 105-107 | 3 | |
| α-helix | 117-126 | 10 | |
| β-strand | 133-137 | 5 | 28 |
| β-strand | 143-147 | 5 | 28 |
| β-strand | 152 | 1 | 58 |
Chain H: 2 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7-16 | 10 | 14 |
| β-strand | 23-30 | 8 | 14 |
| β-strand | 37-43 | 7 | 14 |
| β-strand | 54-58 | 5 | 14 |
| α-helix | 84-86 | 3 | |
| β-strand | 95-98 | 4 | 14 |
| β-strand | 100-105 | 6 | 14 |
| β-strand | 112-118 | 7 | 14 |
| β-strand | 121-127 | 7 | 14 |
| α-helix | 130-133 | 4 | |
| β-strand | 141-145 | 5 | 14 |
Chain I: 1 helix, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6 | 1 | 59 |
| β-strand | 13 | 1 | 59 |
| β-strand | 15-19 | 5 | 60 |
| β-strand | 24-28 | 5 | 60 |
| β-strand | 35-37 | 3 | 60 |
| α-helix | 60-64 | 5 | |
| β-strand | 83-87 | 5 | 61 |
| β-strand | 99-103 | 5 | 61 |
| β-strand | 109-111 | 3 | 61 |
Chain J: 6 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-4 | 2 | |
| α-helix | 15-17 | 3 | |
| α-helix | 18-26 | 9 | |
| α-helix | 32-38 | 7 | |
| α-helix | 44-51 | 8 | |
| β-strand | 53 | 1 | 39 |
| α-helix | 57-60 | 4 | |
3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| DNA-directed RNA polymerase II subunit RPB1 | A | protein | 1733 | Saccharomyces cerevisiae | P04050 (AlphaFold model) |
| DNA-directed RNA polymerase II subunit RPB2 | B | protein | 1224 | Saccharomyces cerevisiae | P08518 (AlphaFold model) |
| DNA-directed RNA polymerase II subunit RPB3 | C | protein | 318 | Saccharomyces cerevisiae | P16370 (AlphaFold model) |
| DNA-directed RNA polymerases I, II, and III subunit RPABC1 | E | protein | 215 | Saccharomyces cerevisiae | P20434 (AlphaFold model) |
| DNA-directed RNA polymerases I, II, and III subunit RPABC2 | F | protein | 155 | Saccharomyces cerevisiae | P20435 |
| DNA-directed RNA polymerases I, II, and III subunit RPABC3 | H | protein | 146 | Saccharomyces cerevisiae | P20436 |
| DNA-directed RNA polymerase II subunit RPB9 | I | protein | 122 | Saccharomyces cerevisiae | P27999 |
| DNA-directed RNA polymerases I, II, and III subunit RPABC5 | J | protein | 70 | Saccharomyces cerevisiae | P22139 |
| DNA-directed RNA polymerase II subunit RPB11 | K | protein | 120 | Saccharomyces cerevisiae | P38902 |
| DNA-directed RNA polymerases I, II, and III subunit RPABC4 | L | protein | 70 | Saccharomyces cerevisiae | P40422 |
| Transcription initiation factor IIB | M | protein | 345 | Saccharomyces cerevisiae | P29055 |
Sequence of entity 1 (A), FASTA
>3K7A_1 DNA-directed RNA polymerase II subunit RPB1 (chains A)
MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGS
IDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNE
LMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLK
LVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHV
ATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLE
LDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKR
AGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTF
IELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSP
KDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHN
GFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFV
DRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRR
LVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVD
LLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCC
LLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMT
LNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEH
TTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHML
KKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVP
GIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGG
LTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGS
NDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTS
PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYS
PTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
Sequence of entity 2 (B), FASTA
>3K7A_2 DNA-directed RNA polymerase II subunit RPB2 (chains B)
MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQ
DIICEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLR
NLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCY
LSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEH
ICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEF
LPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTL
FKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLS
LMSCISVGTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETL
RTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHIAK
LMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGV
FLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMI
MNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIA
PGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSR
MTVAHLIECLLSKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKK
LMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIA
HGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
Sequence of entity 3 (C), FASTA
>3K7A_3 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI
VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY
SNASQMGNTGSGGYDNAW
Sequence of entity 4 (E), FASTA
>3K7A_4 DNA-directed RNA polymerases I, II, and III subunit RPABC1 (chains E)
MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSF
QANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSA
MKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQR
ADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
Sequence of entity 5 (F), FASTA
>3K7A_5 DNA-directed RNA polymerases I, II, and III subunit RPABC2 (chains F)
MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQ
HEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRI
AMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
Sequence of entity 6 (H), FASTA
>3K7A_6 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIA
SSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGG
LLMRLEGNYRNLNNLKQENAYLLIRR
Sequence of entity 7 (I), FASTA
>3K7A_7 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQ
DIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
FS
Sequence of entity 8 (J), FASTA
>3K7A_8 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKF
LRYNPLEKRD
Sequence of entity 9 (K), FASTA
>3K7A_9 DNA-directed RNA polymerase II subunit RPB11 (chains K)
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA
YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
Sequence of entity 10 (L), FASTA
>3K7A_10 DNA-directed RNA polymerases I, II, and III subunit RPABC4 (chains L)
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKAR
TKRLVQFEAR
Sequence of entity 11 (M), FASTA
>3K7A_11 Transcription initiation factor IIB (chains M)
MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTR
SEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMD
KKDNEVQAAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGC
RRAEVARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIP
RFCSHLGLPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ
TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZN | Zinc ion | Zn | 9 |
Primary citation
Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism. Liu, X., Bushnell, D.A., Wang, D. et al. Science (2010) 327:206-209. DOI 10.1126/science.1182015 · PubMed
Other PDB entries of the same protein (UniProt P04050 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5VKO 1.8 Å, SPT6 tSH2-RPB1 1468-1500 pT1471, pS1493
- 9SV6 1.96 Å, CryoEM structure of transcribing RNA polymerase II elongation complex with ATP and Elf1
- 5VKL 2.2 Å, SPT6 tSH2-RPB1 1476-1500 pS1493
- 9W8V 2.23 Å, Structure of post-translocation state of yeast Pol II complexed with a cisplatin-induced…
- 9QEB 2.26 Å, CryoEM structure of transcribing RNA polymerase II elongation complex
- 1TWF 2.3 Å, RNA polymerase II complexed with UTP at 2.3 A resolution
- 9RYB 2.33 Å, CryoEM structure of transcribing RNA polymerase II elongation complex in post-catalysis…
- 9KD8 2.46 Å, The structure of RNA polymerase II elongation complex paused at N-2 state by actinomycin…
- 6NPW 2.49 Å, SSu72/Sympk in complex with Ser2/Ser5 phosphorylated peptide
- 9K7F 2.5 Å, RNA polymerase II elongation complex apo structure.
- 30ES 2.54 Å, Cryo-EM structure of the yeast RNA polymerase II elongation complex with 19-mer RNA in…
- 30EP 2.55 Å, Cryo-EM structure of the yeast RNA polymerase II elongation complex with 19-mer RNA in…
Browse structure collections
About this viewer
MolViewer shows 3K7A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.