3KD7: Designed TPR module

Designed TPR module (CTPR390) in complex with its peptide-ligand (Hsp90 peptide). Determined by X-ray diffraction at 2.85 Å resolution. Released 2 Feb 2010.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: UNIDENTIFIED
Chains: 10
Atoms: 4,433
Mol. weight: 75.1 kDa
Released: 2 Feb 2010

Explore 3KD7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KD7 contains 31 α-helices and 0 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	9-21	13
α-helix	25-38	14
α-helix	43-56	14
α-helix	59-72	14
α-helix	77-89	13
α-helix	93-104	12

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	11-21	11
α-helix	26-33	8
α-helix	35-38	4
α-helix	43-56	14
α-helix	59-72	14
α-helix	77-90	14
α-helix	93-106	14

Chain C: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	10-22	13
α-helix	25-38	14
α-helix	43-56	14
α-helix	59-70	12
α-helix	77-90	14
α-helix	93-106	14

Chain D: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	8-22	15
α-helix	25-36	12
α-helix	43-56	14
α-helix	59-72	14
α-helix	77-90	14
α-helix	93-105	13

Chain E: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	11-21	11
α-helix	25-38	14
α-helix	43-55	13
α-helix	59-72	14
α-helix	77-90	14
α-helix	93-104	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CTPR390	A, B, C, D, E	protein	125	UNIDENTIFIED
Hsp90 MEEVD peptide	G, H, I, J, K	protein	6		Q9H2A1 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>3KD7_1 CTPR390 (chains A, B, C, D, E)
GAMDPGNSAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQ
KAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDPNNAKAKQNLGNA
KQKQG

Sequence of entity 2 (G, H, I, J, K), FASTA

>3KD7_2 Hsp90 MEEVD peptide (chains G, H, I, J, K)
XMEEVD

Primary citation

Crystal structure of a designed tetratricopeptide repeat module in complex with its peptide ligand. Cortajarena, A.L., Wang, J., Regan, L. FEBS J (2010) 277:1058-1066. DOI 10.1111/j.1742-4658.2009.07549.x · PubMed

Other PDB entries of the same protein (UniProt Q9H2A1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ELR 1.9 Å, Crystal structure of the TPR2A domain of HOP in complex with the HSP90 peptide MEEVD

Browse structure collections

About this viewer

MolViewer shows 3KD7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.