1ELR: TPR2A domain of HOP

Name: PDB 1ELR: Crystal structure of the TPR2A domain of HOP in complex with the HSP90 peptide MEEVD
Published: 2000-04-26
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structure of the TPR2A domain of HOP in complex with the HSP90 peptide MEEVD. Determined by X-ray diffraction at 1.9 Å resolution. Released 26 Apr 2000.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,238
Mol. weight: 16.23 kDa
Ligands: NI
Released: 26 Apr 2000

Explore 1ELR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ELR contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	223-237	15
α-helix	241-254	14
α-helix	259-272	14
α-helix	275-291	17
α-helix	296-312	17
α-helix	316-329	14
α-helix	333-348	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TPR2A-domain of hop	A	protein	131	Homo sapiens	P31948 (AlphaFold model)
HSP90-peptide meevd	B	protein	6		Q9H2A1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ELR_1 TPR2A-DOMAIN OF HOP (chains A)
GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCREL
CEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQ
AEKILKEQERL

Sequence of entity 2 (B), FASTA

>1ELR_2 HSP90-PEPTIDE MEEVD (chains B)
XMEEVD

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	1

Primary citation

Structure of TPR domain-peptide complexes: critical elements in the assembly of the Hsp70-Hsp90 multichaperone machine. Scheufler, C., Brinker, A., Bourenkov, G. et al. Cell (2000) 101:199-210. DOI 10.1016/S0092-8674(00)80830-2 · PubMed

Other PDB entries of the same protein (UniProt P31948 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ELW 1.6 Å, Crystal structure of the TPR1 domain of HOP in complex with a HSC70 peptide
3ESK 2.05 Å, Structure of HOP TPR2A domain in complex with the non-cognate Hsc70 peptide ligand
9QQU 2.13 Å, Crystal structure of an engineered TPR domain in complex with the HSP90 peptide MEEVD
3FWV 2.2 Å, Crystal Structure of a Redesigned TPR Protein, T-MOD(VMY), in Complex with MEEVF Peptide
7KW7 3.57 Å, Atomic cryoEM structure of Hsp90-Hsp70-Hop-GR
2LNI Solution NMR Structure of Stress-induced-phosphoprotein 1 STI1 from Homo sapiens,…
2NC9 Apo solution structure of Hop TPR2A

Browse structure collections

About this viewer

MolViewer shows 1ELR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.