3KFO: Nucleoporin NUP133

Crystal structure of the C-terminal domain from the nuclear pore complex component NUP133 from Saccharomyces cerevisiae. Determined by X-ray diffraction at 1.9 Å resolution. Released 26 Jan 2010.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,804
Mol. weight: 33.34 kDa
Released: 26 Jan 2010

Explore 3KFO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KFO contains 17 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	951-966	16
β-strand	971	1	1
α-helix	973-975	3
α-helix	978-992	15
α-helix	996-998	3
α-helix	999-1006	8
β-strand	1009	1	1
α-helix	1012-1025	14
α-helix	1026-1028	3
α-helix	1031-1049	19
α-helix	1056-1067	12
α-helix	1070-1073	4
β-strand	1076-1077	2	2
α-helix	1078-1079	2
α-helix	1081-1084	4
α-helix	1087-1089	3
α-helix	1092-1099	8
α-helix	1106-1123	18
α-helix	1125-1127	3
α-helix	1128-1141	14
β-strand	1146-1149	4	2
β-strand	1154-1157	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoporin NUP133	A	protein	288	Saccharomyces cerevisiae	P36161 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3KFO_1 Nucleoporin NUP133 (chains A)
MSLKYGHVAWIQQILDGSYADAMNTLKNITVDDSKKGESLSECELHLNVAKLSSLLVEKD
NLDINTLRKIQYNLDTIDAEKNISNKLKKGEVQICKRFKNGSIREVFNILVEELKSTTVV
NLSDLVELYSMLDDEESLFIPLRLLSVDGNLLNFEVKKFLNALVWRRIVLLNASNEGDKL
LQHIVKRVFDEELPKNNDFPLPSVDLLCDKSLLTPEYISETYGRFPIDQNAIREEIYEEI
SQVETLNSDNSLEIKLHSTIGSVAKEKNYTINYETNTVEYEGHHHHHH

Primary citation

Structure of the C-terminal domain of Saccharomyces cerevisiae Nup133, a component of the nuclear pore complex. Sampathkumar, P., Gheyi, T., Miller, S.A. et al. Proteins (2011) 79:1672-1677. DOI 10.1002/prot.22973 · PubMed

Other PDB entries of the same protein (UniProt P36161 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6X05 2.1 Å, Nup133 (aa55-481) from S. cerevisiae bound by VHH-SAN4
6X04 2.68 Å, Nup133 (aa55-481) from S. cerevisiae bound by VHH-SAN5
6X02 6.38 Å, Nup84-Nup133 (aa521-1157) from S. cerevisiae bound by VHH-SAN8
6X03 7.3 Å, Nup84-Nup133 (aa521-1157) from S. cerevisiae bound by VHH-SAN8 and VHH-SAN9
8TIE 8.1 Å, Double nuclear outer ring of Nup84-complexes from the yeast NPC
7N84 11.6 Å, Double nuclear outer ring from the isolated yeast NPC
7N9F 37.0 Å, Structure of the in situ yeast NPC
8ZZ1 Structure of the Nup84 sub-complex of the Nuclear Pore Complex
8ZZA Integrative structure and functional anatomy of a single spoke of a nuclear pore complex
8ZZB Integrative structure and functional anatomy of three spokes of a nuclear pore complex
8ZZC Integrative structure and functional anatomy of eight spokes of a nuclear pore complex
8ZZG Integrative structure-function mapping of the nucleoporin Nup133

Browse structure collections

About this viewer

MolViewer shows 3KFO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.