3KG5: Human Ig-beta homodimer

Crystal structure of human Ig-beta homodimer. Determined by X-ray diffraction at 3.2 Å resolution. Released 25 Aug 2010.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,678
Mol. weight: 31 kDa
Released: 25 Aug 2010

Explore 3KG5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KG5 contains 2 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	47-49	3	1
β-strand	52-56	5	2
β-strand	61-66	6	1
β-strand	75-79	5	2
β-strand	87-88	2	2
α-helix	89-91	3
β-strand	96-100	5	1
β-strand	104-109	6	1
β-strand	118-125	8	2
β-strand	132-134	3	2
β-strand	138-143	6	2

Chain B: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	47-49	3	3
β-strand	52-56	5	4
β-strand	60-63	4	5
β-strand	64-66	3	3
β-strand	74-79	6	4
β-strand	87-88	2	4
β-strand	96-98	3	5
β-strand	104	1	3
β-strand	107-110	4	5
α-helix	114-116	3
β-strand	118-125	8	4
β-strand	132-134	3	4
β-strand	138-143	6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B-cell antigen receptor complex-associated protein beta chain	A, B	protein	134	Homo sapiens	P40259 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3KG5_1 B-cell antigen receptor complex-associated protein beta chain (chains A, B)
VPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDEN
PQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGF
STLAQLKQRNTLKD

Primary citation

Structural and Functional Studies of Igalphabeta and Its Assembly with the B Cell Antigen Receptor. Radaev, S., Zou, Z., Tolar, P. et al. Structure (2010) 18:934-943. DOI 10.1016/j.str.2010.04.019 · PubMed

Other PDB entries of the same protein (UniProt P40259 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WSO 3.03 Å, Structure of a membrane protein G
7XQ8 3.3 Å, Structure of human B-cell antigen receptor of the IgM isotype
7XT6 3.63 Å, Structure of a membrane protein M3
7WSP 4.09 Å, Structure of a membrane protein M
9E6G 4.4 Å, Locally Refined Cryo-EM map of 2G12 IgG BCR receptor lacking Fab region view

Browse structure collections

About this viewer

MolViewer shows 3KG5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.