Crystal structure of murine Ig-beta (CD79b) homodimer. Determined by X-ray diffraction at 3.11 Å resolution. Released 25 Aug 2010.
Explore 3KHO in 3D Show helices and sheets RCSB PDB PDBe
3KHO contains 7 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 47-49 | 3 | 4 |
| β-strand | 52-55 | 4 | 5 |
| β-strand | 61-66 | 6 | 4 |
| β-strand | 73-78 | 6 | 5 |
| α-helix | 83-84 | 2 | |
| β-strand | 85-86 | 2 | 5 |
| α-helix | 87 | 1 | |
| β-strand | 94-99 | 6 | 4 |
| β-strand | 102-107 | 6 | 4 |
| α-helix | 112-114 | 3 | |
| β-strand | 116-122 | 7 | 5 |
| β-strand | 137-141 | 5 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 46 | 1 | 1 |
| β-strand | 47-49 | 3 | 2 |
| β-strand | 52-55 | 4 | 3 |
| β-strand | 61-66 | 6 | 2 |
| α-helix | 72 | 1 | |
| β-strand | 73-78 | 6 | 3 |
| β-strand | 84-86 | 3 | 3 |
| α-helix | 87-88 | 2 | |
| α-helix | 90-92 | 3 | |
| β-strand | 94-99 | 6 | 2 |
| β-strand | 102-107 | 6 | 2 |
| α-helix | 112-114 | 3 | |
| β-strand | 116-123 | 8 | 3 |
| β-strand | 131-133 | 3 | 3 |
| β-strand | 134 | 1 | 1 |
| β-strand | 137-141 | 5 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| B-cell antigen receptor complex-associated protein beta chain | A, B | protein | 133 | Mus musculus | P15530 (AlphaFold model) |
>3KHO_1 B-cell antigen receptor complex-associated protein beta chain (chains A, B) PAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQE LVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFST LDQLKRRNTLKDG
Structural and Functional Studies of Igalphabeta and Its Assembly with the B Cell Antigen Receptor. Radaev, S., Zou, Z., Tolar, P. et al. Structure (2010) 18:934-943. DOI 10.1016/j.str.2010.04.019 · PubMed
Other PDB entries of the same protein (UniProt P15530 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3KHO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.